KEGG   Francisella tularensis subsp. novicida: FTN_0530Help
Entry
FTN_0530          CDS       T00432                                 

Gene name
mpl
Definition
UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase
Orthology
K02558  
UDP-N-acetylmuramate: L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase [EC:6.3.2.-]
Organism
ftn  Francisella tularensis subsp. novicida
Brite
Enzymes [BR:ftn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.-  
     FTN_0530 (mpl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
551516..552886
Genome map
AA seq 456 aa AA seqDB search
MSKHIHILGICGTFMGSLAVLAKQKGYRVTGSDLNVYPPMSTYLESQGIEILQGFDCDQL
DTNPDEIIIGNIMKRGMPIIEKILVEKLNYFSGPEWLYQNILKYKKVIAIAGTHGKTTTT
TMTIKILEQAGLNPSFLVGGVSSDFGVSSRYTDSEYFVIEADEYDTAFFDKRSKLIHYDP
SIFVINNIEFDHADIFKDIDAIFWQFHQLLRKMSSTAKIIYNAKDDNVQKIISMGCWSEL
VKVNSDLGISITKHTLDYSKFELCDINGNNVEVSWGLIGEHNALNAMSAYAVAKQLNISD
EVVKDALESFRGVKRRLEVLSHQDNITLYDDFAHHPTSIKLTLEAVRNKAKVAYVVALID
PRSNTMRQGDNKDNLPMSIIEADRVLLYNHSLLKWDAKEVLKNSNNVDFIADVDDFVDCV
DKLLTKHQDRNIQLVMMSNGSFDGLREKLVKLLETK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacatattcatattttaggtatctgtggtacttttatgggctctttagctgta
ttagctaaacaaaaaggatacagagtaacaggttcggatcttaatgtctatccaccaatg
agtacttatctcgagtctcaaggcatagagatattacaaggatttgattgtgatcagtta
gatacaaatcctgatgaaattattattggtaatatcatgaaaagaggtatgccaataata
gaaaaaatcctcgtagaaaagttaaactatttctcaggtccagagtggctttatcaaaat
attcttaaatataaaaaagtaattgcaatagctggaacacatggtaaaactacaaccact
acaatgactatcaaaatactagagcaggctggcttaaatccgagctttttagttggtggt
gttagtagtgattttggtgtttcatcacgttacacagattctgagtattttgtcattgaa
gctgatgaatatgatacggctttttttgataagcgttcaaaactgattcattatgatcca
agtatttttgtgattaacaatattgaatttgatcatgctgatattttcaaagacattgat
gcaatattttggcaatttcaccaactacttagaaagatgtcatcaacagcgaagattatc
tacaacgctaaggatgataatgttcaaaaaataatatcaatgggatgttggtcagagttg
gttaaagtaaattctgatttaggtatcagtataaccaagcacacactagattactcaaag
tttgaattatgtgatattaatggtaataatgttgaagtatcatggggcttaattggtgag
cataatgctcttaatgctatgagtgcctatgctgtagcaaagcaactaaatatatctgat
gaagtggtaaaagacgctttagaaagctttagaggagttaaaagacgtttagaagtatta
tctcatcaagataatattactttatatgatgattttgctcatcatccaacttctattaag
ttaactttagaagcagtgcgtaacaaagctaaagttgcttatgtagtagctcttattgat
ccacgttcaaatacaatgcgtcaaggcgataataaagataatctgccgatgtcaattatc
gaagctgatagagtgttgttgtataatcatagtttattaaagtgggatgctaaagaagtt
ctcaaaaatagtaataatgttgattttatagctgatgttgatgattttgttgattgtgtc
gataaattattaactaagcaccaagatagaaatatccagcttgtaatgatgagtaatggc
tcgtttgatggattaagagaaaagctagttaagcttttggagactaaatga

DBGET integrated database retrieval system