KEGG   Francisella tularensis subsp. novicida U112: FTN_0729Help
Entry
FTN_0729          CDS       T00432                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
ftn00040  Pentose and glucuronate interconversions
ftn00052  Galactose metabolism
ftn00500  Starch and sucrose metabolism
ftn00520  Amino sugar and nucleotide sugar metabolism
ftn01100  Metabolic pathways
ftn01130  Biosynthesis of antibiotics
Module
ftn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FTN_0729 (galU)
   00052 Galactose metabolism
    FTN_0729 (galU)
   00500 Starch and sucrose metabolism
    FTN_0729 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    FTN_0729 (galU)
Enzymes [BR:ftn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     FTN_0729 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 RNA_pol_Rpb1_3
Motif
Other DBs
NCBI-ProteinID: ABK89620
UniProt: A0Q5V5
Position
781822..782685
Genome map
AA seq 287 aa AA seqDB search
MKIRKAVFPVAGWGTRFLPATKSCPKEMLTVVDKPLIQYAVEEAIEAGCKEIIFVTSSNK
KSLEDHFDRNFELEYSLEKKQKYELLDLVKNIIPKDVSFFFVRQPEALGLGHAVLCAKPL
VGIEDFAVILPDDLIYNHDCGTGTLKQMVKAVEGTDIRGCIATQQVKREETNSYGIVAKD
NDNLIKAIVEKPAPEKAPSTNAVVGRYLLPNKIFRCLESTSEGAGGEIQLTDAIAKLLDQ
DEKILSYEFKGTRYDCGSKLGFLIANYEIALQHQELGHKFKEYLQNR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagaaaagcagtttttcctgtagctggatggggtactagatttttaccagca
actaaatcatgccctaaagaaatgctaacagttgttgataaaccattgatccaatacgct
gttgaagaggctatagaggcaggctgtaaagagataatatttgttactagctcaaataaa
aagtccctagaagatcattttgatagaaactttgaattagaatattcgctagaaaaaaaa
caaaaatatgaattgttagatttagtaaaaaatataattcccaaagatgtaagttttttc
tttgtacgtcagccagaggcgctaggactagggcatgcggttttatgtgcaaaaccacta
gttggaattgaggattttgcagttatactacctgatgatctaatttacaatcatgattgt
ggtactggtacgctaaagcaaatggttaaggcggtagaaggtactgatattagaggttgt
atcgcaacgcaacaagtcaagagagaagaaacaaattcatatggtatagttgcaaaagat
aatgataatctaatcaaagcaattgttgaaaagccagcaccagaaaaagcaccatcaact
aatgcagttgtaggtagatatttattaccaaataagatttttagatgtttagaatcaact
tcagagggtgcaggtggtgagattcaactaactgatgctatcgctaaattattagatcag
gatgagaaaattttgtcttatgaatttaagggcactcgttatgattgtggcagtaaatta
ggttttttaattgctaattatgagatagctttacagcatcaagagttaggacataaattc
aaagaataccttcaaaatagatag

DBGET integrated database retrieval system