KEGG   Francisella tularensis subsp. novicida U112: FTN_0730Help
Entry
FTN_0730          CDS       T00432                                 

Gene name
acs
Definition
(GenBank) acyl-coenzyme A synthetase/AMP-(fatty) acid ligases
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
ftn00010  Glycolysis / Gluconeogenesis
ftn00620  Pyruvate metabolism
ftn00640  Propanoate metabolism
ftn00680  Methane metabolism
ftn01100  Metabolic pathways
ftn01110  Biosynthesis of secondary metabolites
ftn01120  Microbial metabolism in diverse environments
ftn01130  Biosynthesis of antibiotics
ftn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTN_0730 (acs)
   00620 Pyruvate metabolism
    FTN_0730 (acs)
   00640 Propanoate metabolism
    FTN_0730 (acs)
  Energy metabolism
   00680 Methane metabolism
    FTN_0730 (acs)
Enzymes [BR:ftn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     FTN_0730 (acs)
Lipid biosynthesis proteins [BR:ftn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   FTN_0730 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABK89621
UniProt: A0Q5V6
Position
782807..784744
Genome map
AA seq 645 aa AA seqDB search
MSYSKFQVSQDFIDQAHINSELYEKLYKESLENPEQFWAKQANRIHWHKPFTKAYNSSFA
PVDIKWFDDGELNVCYNCVDRHLPARANQVAFIWQADNPKKSKKITYRELYHRVCEMANI
LEANGVKKGDVVTIYMPLVPESIYAMLACARIGAIHSVVFGGFSAESLKQRIFNAKSDFV
ITVDEAVRSGKRIAMKAAVDKVVAEIDFIRKVLVVRNTNTDNISWNDNKDICYTQELKKV
SNEHLPQAFAAETPLFMLYTSGSTGAPKGLVHTSAGYLVYASMTHKLVFDYKDHDVYWCT
ADIGWITGHTYVVYGPLANGATSVIFEGVPTYPDASRLWQEVDQHNVSILYTAPTLIRSL
LKVGDEFLANTRRNSLRVLGSVGEPINPEAWNWFVEKAGNNQAPLVDTWWQTETGGHMIT
PLPGAHKLKPGSASKPFFGVEVALLDTDGKEITGVGKGALCIKRATPGMARTIYGDHDRY
LQTYFSSFNGYYFSGDAARRDEDGYIWIEGRMDDVINVSGHRMATAEIEAALNTHPDVAE
SAVVGMPHEIKGEAIYVYCILKEGKSDSKEALDEVRKSLIKYVRQEIGPVATPEVIQFTP
ELPKTRSGKIMRRILRKIAAKDFENFGDTSTLLNPDIVEYLIKNR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtactctaagtttcaagtatctcaggattttattgaccaagcgcatattaattca
gaactatatgaaaaactttataaagaatccctagagaaccctgagcaattttgggctaaa
caagctaatcgtatacattggcataagccttttactaaagcctacaatagtagttttgct
ccagttgatatcaaatggtttgacgatggagaattaaatgtatgctataactgcgttgat
agacacctaccagcaagagcaaatcaagttgctttcatatggcaggctgataatccaaaa
aaatctaagaaaataacctatcgagagttatatcatcgtgtttgtgaaatggctaacata
cttgaggctaatggagtcaaaaaaggtgatgtagtaactatctatatgccattagtacca
gaatcgatatatgctatgctagcatgtgcacgtattggggcgattcattctgtggttttt
ggtggtttctcagcagagtcgctaaaacagcgtatttttaatgctaagagtgattttgtg
ataactgttgatgaggctgttagatcaggcaaaagaatagctatgaaagcggctgttgat
aaggttgttgctgaaattgattttatcaggaaggtcttagttgtgcgtaacactaacaca
gataatattagctggaatgataataaagatatctgctatacccaagagctaaaaaaagtt
tcaaatgagcatttgccacaagcttttgctgctgagacaccattatttatgctctataca
tctggttctacaggagctcctaaaggtctagttcacacttcagctggatatttagtttat
gcaagtatgacacacaaacttgtttttgattataaagatcatgatgtttactggtgtact
gcagatattggttggataacagggcatacatatgttgtctatggacctctagcaaatggt
gcaacatcagtgatatttgagggtgtacctacttatccagatgcttcaaggttatggcaa
gaagttgaccagcataatgtaagtatcttatatactgcgccaactttgataagatcttta
ttaaaggttggtgatgaattcttagcgaatactcggagaaattcgttaagggtattaggt
tcagttggtgaaccaataaatccagaggcttggaattggtttgttgaaaaagctggtaat
aatcaggcgccacttgtagatacatggtggcaaactgagacaggtggacatatgataact
ccactacctggtgcacataaacttaagcctggttcggcttctaaacctttctttggcgtt
gaagtagcattgcttgatactgatggtaaggagataacaggggttggtaaaggtgcttta
tgtataaaaagagcaacacctggtatggcacggacaatttatggtgatcatgatagatat
cttcaaacttatttttctagttttaatggttattatttttcaggtgatgccgcgcgaaga
gatgaggatggttatatttggatcgaagggcgtatggatgatgttatcaatgtctcaggg
catagaatggcaactgcagagattgaagcagcgctaaatactcatccagatgttgcagag
agtgcagttgttggtatgccacatgagattaagggtgaggctatttatgtttactgtatc
cttaaagaaggtaaaagtgattctaaagaggctttagatgaagttagaaaatctctgata
aaatatgtcagacaagaaataggtcctgttgcgactccagaagttatccaatttactcca
gaattaccaaaaactcgttcaggcaaaattatgcgtcgaatcttaagaaaaatagctgca
aaagatttcgaaaattttggtgatacatctacactattaaatccagatatagtagagtat
ctgataaaaaacagataa

DBGET integrated database retrieval system