KEGG   Francisella novicida U112: FTN_0935Help
Entry
FTN_0935          CDS       T00432                                 

Gene name
asnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ftn  Francisella novicida U112
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ftn00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
995336..997189
Genome map
AA seq 617 aa AA seqDB search
MFHGIFFRKDSNLDKIPQQIVDGTNPKLNIDPQRKIIKTIYDKNYWFAQALEKDSNKSIY
IQKNIIIVGWIKLYNRDEIFSELQLEYTEKISDEELIVSLYNKYKSSVTKYLHGDYSFVI
FDSLNNQAVCVRDHMGTRPFYYYLDENIFVFSSSQVLFNLLDIIDISASQEWICRLIAGG
TNMNFKKTAYNEIFKIPPAHFLEISNHHSQIQKYFEFSTEKIILNNDSQYFEEYENKVKQ
AIIERFINSKHPIGSEISGGIDSSTVTAYIANYFDQPISNLYTYGFTKLEQEPEYALLVN
QVYGLPNAFICSGNSYDENNCKNPLDILGAPVEHGNATFHEIFYKNASQNGVRSLFSGFG
GDEFVTSIHGDLVAFELLAKKDYIGICKHFGGNIITKPLRILRFLVKNNIKHGKKSFNML
NAFKQRWPYFCVKDELVEKYRLKDRYFEVANFDNGYTNLDKFTLEKRWVGFVPTRTDNCS
LMAAAYGIDYFWPLLDVRLIQSFLSMPNTLKFHNGYGRYLHRKAVEKIVPKKIIWKKSKY
MGEPFTSKINIKSKLELDTDLHPQLLILLDIDKLKTQIADYNNSIEIDKSVSMVINRNIA
DINAINQWLKHFDLKIK
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcacggcattttttttagaaaagatagtaacttagataaaattccacagcaaata
gttgatggaacaaacccaaaattaaatatagatcctcaaagaaaaataattaaaacaata
tatgataaaaattactggtttgctcaagcattagaaaaagattcaaataaaagtatttat
atacaaaaaaatattattattgtaggttggataaaactatataatcgtgatgaaattttc
tcagaattacagttagaatatactgaaaaaatctcagatgaagaacttattgtatcatta
tataacaaatataaaagctcagttaccaagtacctccatggcgactactcttttgttatt
tttgatagcttaaataatcaagctgtatgtgttagagaccatatgggaactagaccattt
tattattatttagatgaaaatatttttgttttttcttcatctcaagttctatttaacctt
ttagatataatagatatctccgctagccaagaatggatatgtaggctaatagctggtggt
acaaatatgaatttcaaaaaaactgcctataatgagatttttaaaatccctccggcgcat
tttttagaaatttctaatcaccatagccaaatacaaaaatattttgaattctccactgaa
aaaataattttaaataatgatagtcaatattttgaagaatatgaaaacaaagttaaacaa
gcaattattgagaggtttatcaatagtaagcaccctatcggtagtgaaattagtggtggt
atagattcctcgacagttactgcttatattgctaattattttgatcagcctataagtaac
ctttatacatatggatttactaaactagaacaagaaccagaatatgccctgcttgtaaac
caagtttatggtttacctaatgcttttatttgttctgggaatagttatgatgaaaataat
tgtaaaaatcctctagatattttaggagctcctgttgagcatggaaacgctacatttcat
gagatattttataaaaacgcttctcaaaatggcgttcgaagtttattttctggtttcgga
ggcgatgaatttgttacatcaatacatggtgatttggttgcttttgagttgttagctaaa
aaagattatataggaatatgtaaacactttggtggaaacataatcactaaacctctaaga
atattacgttttttagtaaaaaataatattaaacatggtaaaaaaagctttaatatgctt
aatgctttcaaacaacgttggccatatttctgtgttaaggatgaacttgtcgaaaaatat
cgcctcaaagatagatattttgaagtagccaattttgacaatggctataccaacttagac
aaatttaccttagaaaaaagatgggttggctttgtaccaacacgtaccgacaactgttca
ctcatggctgctgcctatggcatagattacttttggccattacttgatgttagattgatt
caaagcttcttatcaatgccaaatactctaaaatttcataatgggtacggtaggtatcta
catagaaaagcagtagaaaaaattgttcctaagaaaatcatatggaaaaaaagtaaatat
atgggtgagccttttactagcaaaataaatattaagtctaaattagagctagatacggat
ctacatccgcaactgctcatattacttgatatagacaagctaaaaactcaaatagcagat
tataataactctattgaaattgataaaagtgttagcatggttatcaatagaaatattgct
gatattaatgctataaaccaatggttgaaacactttgacttgaaaataaaatga

DBGET integrated database retrieval system