KEGG   Francisella tularensis subsp. novicida: FTN_1044Help
Entry
FTN_1044          CDS       T00432                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ftn  Francisella tularensis subsp. novicida
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FTN_1044
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTN_1044
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FTN_1044
Enzymes [BR:ftn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FTN_1044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1102528..1104324)
Genome map
AA seq 598 aa AA seqDB search
MYKILNFYTKEEVSTDSFVFAGENEPWEIQMNINEISKKINKDYFTQASPCLSKYIPFMP
IKDPSSFVSLRESATPLLKSKIIGKELGINLYFKVEGKNPTGSFKDRGSAVDITVAKELG
AKGIVLASTGNMAASCACYAAAAKMPCFIIVPEGVAASKLAQVMSYGGKIVQVKGSYNEA
AKLAYDIAKSKDFFLAGDYAFRVEGQKTAAFELIDQLLFQVPDEVIIPIGCGTNMTAYYK
GFCEYKELGFINSLPKLTGVQSTEADTLARAYQKNQNRIEPLKTANTIATAIAVPYPIDG
DKAIDAIYSTGGESTAVTDMKMLEAQYLLSTKEGLFVELASASTIAHLLKKYEEGRLQKG
STVVCVLSGEGLKDPGVVLKSAIQPPIIYPSETDFDRLYNSHFFDNKTMLFIEQNEVIFD
KLPTLDEVKKTLGKLFGANYDESFVAKVRELIERFLVKGKSINVSDIQDIIQDATEMADA
VSKDVLDVKSFKVKVELDQKSVAEVTVKVAEQLYFASSSGVGPVDAVLNALCKACPSDIS
YNLTDYKVKIRGQGADAVVYVEMSLEKEGIKSIGKAVSPDIIQASVEAFIDAYNIAYA
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaatattaaacttttacactaaagaggaagtttctacagatagttttgtgttc
gctggggaaaatgagccctgggaaattcagatgaatattaatgaaataagtaaaaaaatt
aacaaagattattttactcaagcctcgccatgtttatctaagtatattccctttatgccg
ataaaagatccatcaagctttgtatctttaagagaatcagctacaccattgcttaagagt
aaaataataggcaaagagttaggaattaatctatactttaaagtcgaaggtaaaaaccct
actggttcatttaaagatagaggatcagcagttgatataacagttgcaaaagagcttggt
gctaaagggatagtactagcatctactggtaacatggcggcttcatgtgcttgttacgct
gcagctgcgaagatgccttgctttattattgtgccagaaggtgtagcagcttctaagttg
gctcaggtaatgtcttatgggggaaaaatagttcaagttaagggtagttataacgaagct
gcaaagttagcttatgatattgcaaaatcaaaagatttcttcttggctggagactatgct
tttagagttgaaggtcaaaaaaccgcagcatttgaactaatagatcagttattgttccaa
gtgccagatgaggttataatacctataggttgtggcacaaatatgacagcttattataaa
ggtttttgtgagtataaagagttaggttttattaattctttacctaagcttactggtgtt
caatctactgaagctgataccttagctagagcatatcaaaagaatcaaaatagaattgag
cctctaaaaacagcgaatacaatagcaacagcaatagctgtgccgtatcctatcgatggt
gataaagctatagatgctatatatagtacaggtggagaatctacagctgtaacagatatg
aaaatgttagaggctcaatatttgctatctactaaagagggattatttgttgagttagca
tccgcgtcaactattgcacacttactcaaaaagtatgaggaaggaaggcttcaaaaaggt
agtacagtagtatgtgtattatctggagaaggtctaaaagatccaggtgttgtgcttaaa
tcagctattcaaccaccaattatatatccttcagaaacagattttgacagactgtataat
agtcatttttttgacaacaagacgatgttatttatagagcaaaatgaagttatatttgat
aaattacctactcttgatgaagtcaaaaaaactcttggtaaactttttggtgctaactat
gatgagagttttgtagctaaggttagagagttgattgagagattcctagttaagggtaaa
tcaatcaatgtttctgatattcaagatattatccaagatgctacagagatggcagatgct
gttagcaaagatgttttagatgttaaatcatttaaggtaaaagtagaattagatcaaaaa
tctgttgctgaggttactgtaaaagtcgctgaacagttatactttgcatcaagttctggt
gtcggacctgtcgatgctgttttaaatgctttgtgtaaagcttgtcctagtgatattagt
tataatctaactgactataaagtaaaaatacgtggacagggtgcggatgctgttgtttat
gttgaaatgagtttagaaaaagaaggtatcaagagtattggtaaagcagtatctccagat
ataattcaggcgtcggttgaagcatttattgatgcctataatattgcgtatgcttaa

DBGET integrated database retrieval system