KEGG   Francisella tularensis subsp. novicida: FTN_1128Help
Entry
FTN_1128          CDS       T00432                                 

Gene name
dfp
Definition
P-pantothenate cysteine ligase/P-pantothenoylcysteine decarboxylase
Orthology
K13038  
phosphopantothenoylcysteine decarboxylase / phosphopantothenate--cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
ftn  Francisella tularensis subsp. novicida
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    FTN_1128 (dfp)
Enzymes [BR:ftn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     FTN_1128 (dfp)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase
     FTN_1128 (dfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1190296..1191471)
Genome map
AA seq 391 aa AA seqDB search
MSNKILFGITGSVSAFKTINLIRLFIKSGVECRAIVTKGAQQFIKPELLVALGCDVYTDE
KLDMLSYQQIMAHINLSRWADKIFIIPASANTIAKLAHGLADDLLSQTILANDDNSKVYI
APAMNVNMWQNQLTQMNITKLQSIGFILIAPDQGVQACGDIGSGRLHEPEVLFDLLSVSQ
DFKAKKVVITVGATVEDIDGVRYLSNYSSGKMGFALVRELLARGASVVVLKAKTTISFDI
KHPNLEIINTKSADDMNQAMLEKAKDSDIFIGCAAVADYKIKNKFTNKIKKTDDTLTLEF
IKNPDVLANCKKTYPNIFAIGFAAESQNIVDYAQAKLVKKNLNMVVANSTEVFGNDNSSV
TILSKHQTKQYNNKSKSEIAKLILDFAKEII
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataagattttatttgggatcactggcagtgtatcagcttttaaaactataaat
ttgataagactttttattaaaagtggtgttgaatgtagagctatagttactaaaggtgca
cagcagtttataaagcctgaacttttagtagctttaggctgtgatgtttatactgatgaa
aaactagatatgttatcttatcagcaaattatggcacatataaatttatcacgttgggca
gataagatattcataattccagcttcggcaaatactattgcaaaattagctcatggttta
gcagatgatttattaagtcaaacaatattagctaatgatgataattctaaggtatatata
gctcctgctatgaatgtaaatatgtggcaaaatcaactaactcagatgaatatcacaaag
cttcaaagtatagggttcattttgattgctccagatcaaggcgttcaagcttgtggagat
attggtagtggtagattacatgagccggaagtcttgtttgatttattgagtgtttctcaa
gatttcaaagctaaaaaagtagtgataacagtaggagcaactgtagaagatattgatggt
gttagatatttatcaaattatagctctggtaaaatgggctttgctttggtaagagagtta
cttgcaagaggagcgagtgttgtagtattaaaagcaaaaactacaataagctttgatatt
aaacatcctaatttagaaattattaataccaaaagtgctgatgatatgaaccaagcaatg
cttgaaaaagctaaagatagtgatatttttataggctgtgctgcagttgctgattataag
atcaaaaataaatttactaataaaattaaaaaaactgatgatacattaactttagagttt
ataaaaaatcctgatgttttagctaattgtaaaaaaacatacccaaatatctttgctata
ggttttgcagcagaatcacaaaatatagtagattatgctcaggctaaacttgtcaaaaag
aatctaaatatggtagttgcaaattcaactgaagtatttggtaatgataactcaagtgta
acaatattatctaagcatcaaactaaacaatataacaacaaatcaaagtcagaaatagct
aagttaatattagattttgctaaggaaataatatga

DBGET integrated database retrieval system