KEGG   Francisella tularensis subsp. novicida U112: FTN_1197Help
Entry
FTN_1197          CDS       T00432                                 

Gene name
recR
Definition
(GenBank) RecFOR complex, RecR component
  KO
K06187  
recombination protein RecR
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FTN_1197 (recR)
DNA repair and recombination proteins [BR:ftn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     FTN_1197 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      FTN_1197 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1270028..1270630
Genome map
AA seq 200 aa AA seqDB search
MTSKIFSPKISAVIESLRKLPTIGKKSSQRLALYLLDKSPETARAIANSLLDATANIKKC
VYCQALTEDDVCNICSNTNRDDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLDGV
GPSELKLDILQRIIADRKIDEVILAISPTVEGETTAHFISQMIAKDIKISRIGFGVPFGG
ELEYLDQQTLLHAFNARTNI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcaaaattttttctccgaaaattagcgctgtaatagaatctttgcgtaagcta
ccaactattggtaaaaaatcatcacaaagacttgctctatatctactagacaaatcacct
gaaacagcaagagctattgccaactcgcttttagatgccacagcaaatatcaaaaaatgt
gtatattgccaagcacttactgaagacgatgtttgtaacatatgtagtaacactaatcga
gatgataccaaactatgtataatagaaagtatgcttgatatgattgctattgaagaggct
ggtatctatagaggtaagtattttgtattaaatggtagaatttctccactagatggcgta
ggtccaagtgaattaaagctagatatcttacaacgaattatcgctgatagaaaaatcgat
gaagtaattcttgcaattagcccaactgtagaaggtgaaacaacagctcattttatttca
caaatgattgcaaaagatataaaaatctcacgcattggttttggagtaccatttggtggt
gaattagaatacttagatcaacaaactttactacatgcttttaatgcaagaactaatatt
taa

DBGET integrated database retrieval system