KEGG   Francisella tularensis subsp. novicida U112: FTN_1356Help
Entry
FTN_1356          CDS       T00432                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
ftn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FTN_1356 (recD)
Enzymes [BR:ftn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FTN_1356 (recD)
DNA repair and recombination proteins [BR:ftn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     FTN_1356 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Viral_helicase1 UvrD_C_2 AAA_11 Helicase_RecD DUF2075 UvrD-helicase UvrD_C AAA_22 PhoH ResIII Flavi_DEAD AAA_12 NACHT T2SSE TrwB_AAD_bind SRP54 AAA_24 AAA DEAD AAA_28 TIP49 Terminase_6 FtsK_SpoIIIE AAA_33 NIL CbiA
Motif
Other DBs
NCBI-ProteinID: ABK90231
UniProt: A0Q7L6
Position
complement(1433559..1435358)
Genome map
AA seq 599 aa AA seqDB search
MLVYLMEMIMYKTFHKACEQLADIRAIDFFFAKEVFDLVKKTTPSMTTLSSESYPPLHGA
KGNDLEQKSNEILFHILMKLMHVYSHGHSCLKIADISNKTIFASEQSNQSDAKVGFKMPS
SDKIANILDSLNYDNLPIYFAKQYDSLYIKRLWNYENEIANFIKLKTIQNTQKDNRIEEV
VDKLFEPAGEINWQKQAVIKSLNYNFSIISGGPGTGKTTTVAKLLLAIQMLNQNQQRIAL
LAPTGKAAQRMTESLNSVLSKRVDNDSYLGLSNLEAQTIHRFLGLRPNSTHVKYSKQSKA
PYDVIIVDEASMLDMNIFIKLIRAVADNTKLILIGDTNQLPSVEAGSLLANFTHDKYGSI
TPYTTLLIKNYRSQQYINNLAASVLKGDVNIDSHQNENINFHSLRNLDTYLREYAKRYSQ
LEKCRNYKEALTELNKFRILVANKNLEIGTDKLNQKIEKFMSKPIDSNYKGKPIMITQNS
YSLGLFNGDVGIIWPDDTGKLRAYFDGKDAKAFSLNMLPKYESVYAMTIHKTQGSEFDEI
VIILPAEDNEALSKQLLYTAITRAKYKLTIISEQSSLRDIAQKDIKRNSNISELVSLSD
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
ttgctagtttatttaatggagatgataatgtataaaactttccataaagcttgtgagcaa
ttagcagatattagagccatagattttttctttgctaaagaggtgtttgatttagtcaaa
aagactactccgtctatgaccactttatcaagtgagtcatatccaccccttcacggagca
aaggggaatgatttggaacaaaaaagtaatgaaattttatttcatattctgatgaaactt
atgcatgtatatagccatggtcatagctgtttgaagatagcagatatatcaaataaaact
atttttgcttcagagcaaagtaatcagagtgatgctaaagtagggtttaaaatgccaagc
tctgataaaattgcaaatattttagatagcttaaattacgataatttacctatatatttt
gccaaacagtatgattctttgtatattaaaagattgtggaattatgagaatgaaatagct
aactttataaaattaaaaacaatccaaaatactcaaaaagacaatcgtattgaagaagtt
gtagacaaactatttgaacctgctggtgaaatcaactggcagaaacaggcagttatcaaa
agtctaaattataattttagtattatctcaggtggaccaggtacaggtaagacaactaca
gtcgcaaagcttttacttgctatacaaatgcttaatcaaaatcagcaaagaatagcgctt
ttagcaccaactggtaaggctgctcagagaatgacagaatccttaaatagtgtattaagt
aaaagggtagacaatgatagttatttggggttatctaatttagaagctcaaactatacat
aggtttttaggcttaagaccaaactctactcatgtgaaatatagcaagcagtcaaaagca
ccatacgatgtgattattgttgatgaagcttcgatgcttgatatgaatatttttattaag
ttgattagagcagtagctgataataccaagctaattttgataggtgatactaatcagtta
ccatctgttgaggctgggagtcttttagcaaactttacacatgataaatatggtagcatt
acgccatatacaacattacttatcaaaaactatcggtcacaacaatatataaataatctt
gcagcctcagtcctaaaaggcgatgttaatattgatagtcatcaaaatgagaatattaat
tttcatagtttaagaaatttagatacttatttaagagagtatgcaaagagatactcacag
cttgaaaagtgccgtaactacaaagaggctcttaccgagctaaataaatttagaatactt
gtggctaacaaaaacctagaaattggtacagataagttaaatcagaaaattgagaagttt
atgtctaagcctatagattctaactataagggtaaaccaattatgataactcaaaatagt
tattcattagggttatttaatggagatgtagggattatctggcctgatgatactggtaag
ctccgagcatattttgatggtaaagatgctaaggcatttagtctaaatatgctaccaaaa
tatgaaagtgtttatgcgatgacaattcataaaactcaaggctcagagtttgatgaaatc
gtgattattcttccagcagaagataatgaagcgctaagtaaacaacttttgtatacagct
atcactagagcaaaatataaattaacgattatatctgaacaaagtagcttaagagatatt
gctcagaaagatattaagagaaattcaaatatcagtgaattagttagcttgagtgattaa

DBGET integrated database retrieval system