KEGG   Francisella tularensis subsp. novicida U112: FTN_1373Help
Entry
FTN_1373          CDS       T00432                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
ftn00860  Porphyrin and chlorophyll metabolism
ftn01100  Metabolic pathways
ftn01110  Biosynthesis of secondary metabolites
ftn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FTN_1373 (hemD)
Enzymes [BR:ftn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FTN_1373 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABK90245
UniProt: A0Q7N0
Position
complement(1453011..1453760)
Genome map
AA seq 249 aa AA seqDB search
MKILVCRPQNDAVNLTEKLCANGLLAVSLPTIKICYQKITESVLDYTSLVFTSKYAVESL
FSQYPIDLFKNKKIYSVGASTAAILEKYQLAAIYPVRHGSQELLDIILNQDISKEKFAII
SGVSGNDLLLEELSKLTQCHKFETYSRVFIDLDELVDTYNKLFLHNQPDIIIATSLDVFK
SLNRIFEKITTPKAATITITSLKMLKFVNQQGFKNTLKLEKLDNSYICQRILEFTEAKDV
SRKKHPATK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatactagtttgtcgccctcagaatgatgctgtcaatttaacagaaaaactctgt
gcaaatggtcttttagcggtaagtttaccaactatcaaaatttgttatcaaaaaattact
gagagtgttcttgactatacaagtctagtttttactagtaaatatgctgttgaaagcttg
tttagtcaatatccaatcgatttgtttaaaaataaaaagatctatagtgtcggtgccagt
actgctgctatattagaaaaataccaattagctgcaatatatccagttagacatggctca
caagaacttttagatatcatattaaatcaagatatttctaaagaaaagtttgcgattatt
tctggtgtctctggtaatgatcttttgcttgaagagttatcaaaattaacacagtgtcat
aaatttgagacgtattcacgagtttttatagaccttgatgagttggtagatacttataat
aaactttttttacataatcagccagatattataattgctacaagccttgatgtttttaaa
tcattaaatagaattttcgaaaaaataactactccaaaggctgcaacaattaccataaca
agcctaaaaatgctaaaatttgttaatcaacaaggctttaaaaataccttaaaacttgag
aaactagataatagttatatctgtcaaagaatactagaatttacagaggcaaaagatgtc
agtagaaaaaaacacccagcaacaaaatag

DBGET integrated database retrieval system