KEGG   Francisella tularensis subsp. novicida: FTN_1421Help
Entry
FTN_1421          CDS       T00432                                 

Gene name
wbtH
Definition
glutamine amidotransferase/asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ftn  Francisella tularensis subsp. novicida
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FTN_1421 (wbtH)
Enzymes [BR:ftn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     FTN_1421 (wbtH)
Peptidases [BR:ftn01002]
 Cysteine Peptidases
  Family C44
   FTN_1421 (wbtH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1499938..1501830)
Genome map
AA seq 630 aa AA seqDB search
MCGIVGFYLFERNEDFTSIINQSLLSIKHRGPDDSGYWCDDQVTLGHTRLSIHDISNAGH
QPMLSNSGNTAIVFNGEIYNYLSIKNQLLSEYSNLKFKSNSDTEVLVNAIELWGIDKTLE
KCIGMFAFGVYSRKTSCLILARDRFGEKPLYFGIQNGILGFASELKALKPLKECGWRFDI
DRDALATYMRYAYVPTPYSIYKNISKLNVGSYIKFDAKGNSKEYKYWDSKKVLDSEKYKD
SYDQAILDLEIKLKSTLSIQMQSDVPLGAFLSGGIDSTTVVALMQSMSKNKINTFSIGFN
QKEYNEAEHARAVAKHIGTNHTDMYVTERDALDVIPKLAGIYDEPFADSSQIPTYLVSKI
AKSKVTVALSGDAGDELFGGYNRYFLAPNIAKKIKFAKLLKYAPDAWIKKAEILNFGKFA
LLADKLLKLKRVLEKAKTNKELYVLLCSQINDTSFVLGAKEYDILRDKNIYDIPQLSFQE
WMMFVDSNTYMIDDILVKVDRAAMANSLETRVPFLDHNIYEFAYSLPIDYKIQQGNGKRI
LKDLLYKYVPESLVNRPKMGFGIPLAKWLREDLREWADNLLDYSKIDKQGYLSPEVVQKY
WQEHLSGKRNWQAILWNILMFQEWFKKEGL
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatagtaggtttttatttatttgaaagaaatgaagattttacatcaataatt
aaccaatcattgctttctataaagcatagagggccggatgatagtgggtattggtgcgac
gatcaagttactctggggcatactagattatcaatacacgatatatctaatgcgggacat
cagccaatgttatctaatagcggtaatactgctattgtgtttaatggagaaatatataat
tacttatccataaaaaatcagctattaagtgaatattcaaatcttaaatttaaaagtaac
agtgatactgaggttttggtcaatgctattgagctttggggtatagataaaactttagaa
aaatgcataggaatgtttgcttttggagtttacagtagaaaaactagttgtttaatacta
gctagagatagatttggcgagaagccattatattttggtatccaaaatggtattttgggt
tttgcatcagaattgaaggcacttaagccattaaaggaatgtggctggaggtttgatata
gatagagatgctttagcaacatatatgaggtatgcttatgtaccaacaccatactctatt
tataaaaatatatctaaactaaatgtaggtagttacataaaatttgatgctaaaggtaat
agtaaagagtataaatattgggattctaaaaaagtactagattcagaaaaatataaagat
tcgtatgatcaagcaatcctagatttagaaattaagcttaaaagtacactatcaatacaa
atgcagtcagatgttcctctaggagcatttttatccggaggaattgactcaacaactgta
gttgctcttatgcaaagtatgtctaaaaataagataaacacttttagtataggttttaat
caaaaagaatataatgaagctgagcatgcaagagcagtagcaaaacatataggtacaaac
cacacagatatgtatgttacagaaagagatgctcttgatgtaataccaaaacttgctgga
atatatgacgagccctttgctgattcatcacaaataccaacgtatcttgtgagtaaaata
gctaagtcgaaagtaacagttgcactatcaggtgacgctggtgatgagctctttggcggt
tataatagatactttttagcaccaaatattgctaaaaaaatcaaatttgctaagttactt
aaatatgcaccagatgcttggataaaaaaagctgagatattaaattttggtaagttcgct
ttattagcagataaactactaaaactaaaaagagttctcgaaaaagcaaaaacaaataaa
gagctttatgtactactttgttcacaaataaatgatactagctttgtgttaggagcaaaa
gagtatgatatattaagagataagaatatttatgatattccacaattatctttccaagag
tggatgatgtttgttgattctaatacatatatgatagatgatatattggttaaggttgat
agagcagctatggctaactctctagagacaagagtgccatttttagatcataatatttat
gaatttgcttattccttaccaattgactataaaatacaacaaggtaacggaaaaagaatt
ttgaaagatttgttatataaatatgtgccagaaagtttggtcaataggcctaaaatgggg
tttggtattccgcttgctaaatggttaagggaagatttacgagagtgggcagataattta
ctggattatagtaaaatagacaagcaaggttacttaagtcctgaggtggtgcaaaaatat
tggcaagagcatttgagtggtaaaagaaattggcaagcaatattatggaatattctaatg
tttcaggagtggtttaaaaaagaaggcttataa

DBGET integrated database retrieval system