KEGG   Francisella novicida U112: FTN_1460Help
Entry
FTN_1460          CDS       T00432                                 

Definition
delta 9 acyl-lipid fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ftn  Francisella novicida U112
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ftn01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ftn01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1547752..1548582
Genome map
AA seq 276 aa AA seqDB search
METQSNKLTIVAFAIMHLACLAIFFVNYNITALVVFVVTFSARTFALTAGYHRYFAHKAF
QTSRVFQFILALVGTWASQKGPLWWSGHHRYHHIHSDKDTDLHSPKNGIFQSHVGWVFES
RSDHVDPKFTKDWVKYPELVWIDKYAHVSFALYLVGLFALGSLISHFYPSLETSGLAFVF
WGGILSTVLLYHTTFSVNSICHIFGSKDYETSDNSRNNWFIALITFGEGWHNNHHKFAYS
VRNNLKVWQIDITYMILCVLRKFRIVWDFKQPKKTI
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacagtctaataaattgacaatagtagcatttgctattatgcacttagcctgc
ttggcaatattttttgtaaattataatattacagctctagttgtatttgttgttacattc
tcagctagaacatttgctttgacagctgggtaccatcgttactttgcacacaaagctttt
caaacctctagagtgtttcaatttatcttagcgttagtaggtacttgggcatcgcaaaaa
ggaccgctttggtggtcaggacatcatagatatcatcatatccattctgataaagataca
gacctacactcgcctaaaaatggtatctttcaatcacacgtaggctgggtttttgaatct
agaagtgatcatgttgatcctaaatttactaaagactgggttaagtatcctgagctggta
tggatagataaatatgctcatgtatcatttgctctatatctggtagggctttttgcttta
gggagtctaattagccacttttatccaagccttgaaacatctggactagcatttgtcttc
tggggagggatattaagtaccgtcttactatatcatactacttttagtgtaaactcaatt
tgccatatctttggatctaaagattacgaaacttcagataatagtcgcaacaattggttt
atagctctaattacatttggtgaaggttggcataataatcatcataaatttgcttactcg
gttagaaataatcttaaagtatggcaaatagacattacctatatgattttatgcgtcttg
agaaaatttagaatagtttgggattttaagcaaccgaagaaaactatttag

DBGET integrated database retrieval system