KEGG   Francisella novicida U112: FTN_1585Help
Entry
FTN_1585          CDS       T00432                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ftn  Francisella novicida U112
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ftn00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1682445..1683947)
Genome map
AA seq 500 aa AA seqDB search
MSKDFILAVDQGTTSSRAIIFDKKGNIRKIAQKEFTQIYPKSGWVEHDAMEIWGTQSGVM
REALEFGRVKPDQIAAIGITNQRETVVVWDKETGDPVYNAIVWQCRRTSSICDEIKRDPQ
FVKYIKENTGLVVDAYFSGTKVKWILDNVEGAREKANAGKLLMGTIDTWLIWNLTRGKVH
ATDYSNASRTMLFNINSLEWDKKILDYLNIPESMLPEVKNSSEVFGVTDSHTLGGAEIPI
AGVAGDQHAALFGHCCFEKGMAKNTYGTGCFALMNVGDKPVYSDEGLLTTIAWAENGKPT
YALEGSVFIAGAVIQWIRDGLGLVRSAEDSEYYATKIDSTNGVYLVPAFVGLGTPYWDMY
ARGTIVGITRDTKREHIIRAALEAIAYQAKDVLECMKEDTGLDLAGLRVDGGAVQNNFLM
QFQSDILQSEISKPKINEITGLGAVFLAGLAVGFWKDKQELKSILTTEKVFEPQKDSQAV
AHDYRGWKKAVERSKAWAEC
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagatttcatcttagctgtagatcaaggtacaacaagttcacgagcaattatc
tttgataaaaagggtaatataagaaagattgctcaaaaagaattcacacaaatatatcct
aaaagtggttgggtagaacatgatgcaatggaaatatggggtactcaaagtggcgtaatg
cgtgaggcactagagtttggccgcgttaagccagatcaaattgccgcaataggtattaca
aatcagcgtgagacagttgtagtttgggataaagaaacaggtgatcctgtctataatgct
atagtgtggcaatgtcgccgtacttcgagtatttgtgatgaaatcaaacgagatcctcaa
tttgtgaaatatattaaagaaaataccggtctggttgtagatgcgtatttttcaggcact
aaagtaaaatggattttagataacgttgaaggtgctagagaaaaagcaaatgccggcaaa
ttattaatgggcactatagatacttggttgatttggaatctaactcgcggtaaagtgcat
gcgacagactatagtaatgcttcgcgcactatgttatttaatattaatagtttagagtgg
gataaaaaaatacttgattacttaaatattcctgaatcaatgttacctgaggttaaaaac
tcaagtgaggtttttggagttacagatagccatactttaggtggtgctgagattcctatt
gcgggtgttgcaggagatcagcatgcagcattatttggtcattgctgttttgaaaaaggt
atggcaaaaaatacttatggtacgggttgttttgcgttgatgaatgtcggcgataagcca
gtttattcagatgaaggtttattgaccactattgcatgggcagaaaatggtaagccaact
tatgctttagaaggtagtgtatttatagcaggagctgttattcagtggattcgtgatggt
ttgggactagtgcgttctgctgaggatagtgagtactatgctactaagattgattctaca
aatggtgtatatttggtgcctgcgtttgttggtcttggcacaccatattgggatatgtat
gctcgtggtacgatagttggcattacccgtgatacaaagcgtgagcatattattcgtgca
gctttagaggctatagcatatcaagctaaagatgtcttagaatgtatgaaagaggatacg
ggacttgatcttgctggtttgcgtgttgatggtggcgcggtacaaaataacttcctaatg
cagtttcaatctgatattttacaatctgaaatctcaaaaccaaaaataaatgaaattact
ggtttgggggctgtcttcttagctggtttagcagttggtttttggaaggataaacaagaa
ttgaaatctattcttacaactgaaaaagtttttgaaccgcaaaaagattctcaagctgtt
gctcatgattatagaggttggaagaaagcagtagaaagaagtaaggcttgggcagagtgt
taa

DBGET integrated database retrieval system