KEGG   Francisella tularensis subsp. novicida: FTN_1631Help
Entry
FTN_1631          CDS       T00432                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ftn  Francisella tularensis subsp. novicida
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FTN_1631 (tpiA)
   01230 Biosynthesis of amino acids
    FTN_1631 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTN_1631 (tpiA)
   00051 Fructose and mannose metabolism
    FTN_1631 (tpiA)
   00562 Inositol phosphate metabolism
    FTN_1631 (tpiA)
Enzymes [BR:ftn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FTN_1631 (tpiA)
Exosome [BR:ftn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FTN_1631 (tpiA)
  Exosomal proteins of bladder cancer cells
   FTN_1631 (tpiA)
  Exosomal proteins of melanoma cells
   FTN_1631 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1741302..1742063)
Genome map
AA seq 253 aa AA seqDB search
MQKLIMGNWKMNGNSTSIKELCSGISQAQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVG
LQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTIT
PVVCIGESLDDRQSGKLKQVLATQLSLILENLSVEQLAKVVIAYEPVWAIGTGVVASLDQ
IQETHQFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKAAEF
NEIINQANKICTE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaataatgggtaactggaaaatgaatggtaactctacaagcataaaagag
ctctgtagtggtatatcacaagcgcaatatgatacttcaagagtagctattgctgttttt
ccatcaagtgtttatgttaaagaagtaatctcacagctgccagagaaagtaggtgttggt
ctacaaaatattactttttatgatgatggtgcttatactggcgagatatctgctagaatg
ttggaagatattggttgtgactatttactaattggtcattctgagagaagatctctattt
gctgagtctgatgaagatgtttttaaaaagcttaacaagattatagatactactataacg
ccagtagtgtgtattggtgaatcattagatgatagacaaagtggtaagctcaaacaagtt
ttagcaacacaactaagcttaatcttagaaaatttatctgttgagcagctagcaaaagtc
gtaattgcatatgaacctgtctgggcaataggcacaggagttgtggcttcactagatcag
attcaagaaacacatcaatttattcgttcattgttagctaaagttgatgaaagacttgct
aaaaatataaaaatagtgtatggtggtagcctaaaagctgaaaatgctaaagatatatta
agcttaccagatgttgacggtggtttaattggtggcgcatctttgaaggctgctgaattt
aacgaaataataaatcaagcaaacaagatatgtacggaataa

DBGET integrated database retrieval system