KEGG   Francisella tularensis subsp. novicida U112: FTN_1739Help
Entry
FTN_1739          CDS       T00432                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
ftn00260  Glycine, serine and threonine metabolism
ftn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ftn01100  Metabolic pathways
ftn01110  Biosynthesis of secondary metabolites
ftn01130  Biosynthesis of antibiotics
ftn01230  Biosynthesis of amino acids
Module
ftn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTN_1739 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FTN_1739 (trpB)
Enzymes [BR:ftn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FTN_1739 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF2683
Motif
Other DBs
NCBI-ProteinID: ABK90591
UniProt: A0Q8M6
Structure
PDB: 

Jmol
Position
1866821..1868011
Genome map
AA seq 396 aa AA seqDB search
MSKLNAYFGEYGGQFVPQILVPALDQLEQEFIKAQADESFKQEFKELLQEYAGRPTALTK
TRNIVKNTKTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
ACALLDLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSATLKDACNEALRDWSANY
SKAHYLLGTAAGPHPFPTIVREFQRMIGEETKQQILAKEGRLPDAVIACVGGGSNAIGMF
ADFIDEKNVKLIGVEPAGKGIETGEHGAPLKHGKTGIFFGMKAPLMQNSDGQIEESYSIS
AGLDFPSVGPQHAHLLAIGRAEYASATDDEALDAFKLLCKKEGIIPALESSHALAHALKL
AYEDPNKEQLLVVNLSGRGDKDIFTVHDILKEKGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaactaaatgcttattttggtgagtatggtggtcaatttgtaccacaaatactt
gtcccagctcttgatcaactcgagcaagaatttataaaagcacaagctgatgaatctttt
aagcaagaatttaaagagcttttgcaagagtatgcgggtcgccctacagctcttacaaaa
actagaaatatagtcaaaaacacaaaaaccacactctacctaaaacgcgaggatctacta
catggcggcgctcacaaaactaaccaagtacttggtcaagctctactagccaagagaatg
ggtaaaaaagagataattgcagaaactggagctggtcagcatggtgttgctactgctttg
gcttgcgcactacttgatctaaaatgcagagtatatatgggtgctaaggatgttgaacgc
caaagccctaatgtctttagaatgaaattaatgggtgctgaagtcatacctgtacatagt
ggctcagctactcttaaagatgcttgtaacgaagcactaagagattggtcagcaaactat
agtaaggctcattacctactaggtactgccgctggacctcatccttttccgacaattgtt
agagaatttcaaagaatgattggtgaagaaaccaaacaacaaatccttgctaaagaaggt
agactacctgatgctgtgattgcttgtgttggaggtggctcaaatgctatcggtatgttt
gctgactttattgatgaaaaaaatgtcaagcttataggtgtagaacctgctggtaaaggt
atcgaaactggtgagcatggagctccgcttaaacatggtaaaactggtatattttttggt
atgaaggcaccactaatgcaaaactcagacggacaaattgaagagtcatactctatatca
gccggtctagatttcccgtctgttggcccgcagcacgcccatctactagcaataggtcgt
gctgaatatgcatctgctactgatgatgaagcgttagatgcttttaaattactctgtaaa
aaagaaggaattatcccagctctagaatcatctcacgccttagcacacgctcttaaactt
gcttatgaggatcctaataaagagcaacttttggttgttaatctatctgggcgtggtgat
aaggatatttttacagtgcatgatattttaaaagaaaagggagagatttag

DBGET integrated database retrieval system