KEGG   Francisella tularensis subsp. novicida: FTN_1740Help
Entry
FTN_1740          CDS       T00432                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ftn  Francisella tularensis subsp. novicida
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FTN_1740 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTN_1740 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FTN_1740 (trpA)
Enzymes [BR:ftn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FTN_1740 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1868014..1868820
Genome map
AA seq 268 aa AA seqDB search
MDRYTTLFANLEKRNEGAFIPFVTIGDPNKELSLEIIDTLVSSGADALELGIPFSDPLAD
GPTIQEANIRALESGITPKDCFDVLTKIRAKYPDIPIGLLLYANLVYANGIENFYQKCLD
AGVDSILIADVPAHESKEFRDIAKKVGIAQIFIAPPDASESTLKQISELGSGYTYLLSRV
GVTGTETAANMPVEDVLAKLREYNAPKPVLGFGISKPEQVQQAIKAGAAGAISGSATVKI
IQNNISNKQKMLNELTYFVKEMKAATLN
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggatagatatacaaccctttttgcaaatttagagaaaagaaatgaaggagcttttata
ccttttgtaacaattggtgacccgaataaagaactatctcttgaaattatcgatactcta
gttagctcaggtgctgatgctcttgagttgggtatacctttttcagatcccttagcagat
gggccaacaattcaagaagcaaatattcgcgctctggagagtggaataacccctaaagat
tgtttcgatgttctaactaaaataagagcaaaataccctgatatccctattggtttacta
ctttatgctaatttagtctatgcaaacggtatagagaacttttatcaaaaatgtttagat
gcaggtgttgattctatacttatagctgatgtaccagctcacgaatctaaagagtttcgt
gatattgctaaaaaagttggtatagcacaaatatttatcgctcctcctgatgctagtgag
tcaactcttaaacaaatttctgaacttggtagtggttatacgtatttactatcgagagtt
ggtgtaacagggacagaaactgctgcaaatatgcccgtcgaggatgtattggctaaactt
agagaatataatgctcctaaaccagttttaggctttggtatctctaaacctgagcaagta
caacaagctatcaaagctggtgctgctggtgcaatttcaggctcagcaacagtgaaaatt
attcaaaataatatctctaataaacaaaaaatgcttaatgaacttacatattttgttaaa
gagatgaaagcagctactttaaattaa

DBGET integrated database retrieval system