KEGG   Francisella tularensis subsp. holarctica PHIT-FT049: X557_02980Help
Entry
X557_02980        CDS       T03033                                 

Definition
(GenBank) hypothetical protein
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
fto  Francisella tularensis subsp. holarctica PHIT-FT049
Pathway
fto01040  Biosynthesis of unsaturated fatty acids
fto01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fto00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    X557_02980
Enzymes [BR:fto01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     X557_02980
Lipid biosynthesis proteins [BR:fto01004]
 Desaturase
  First
   X557_02980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AHH47175
Position
complement(536926..537201)
Genome map
AA seq 91 aa AA seqDB search
MTAGYHRYFAHKAFQTSRVFQFILALVGTWASQKGPLWWSGHHRYHHIHSDKDTDLHSPK
NGIFQSHVGWVFESRSDHVDPKFTKDWVKLS
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
ttgacagctggataccatcgttactttgcacacaaagcttttcaaacctctagagtgttt
caatttatcttagcgttagtaggtacttgggcatcgcaaaaaggaccgctttggtggtca
ggacatcatagatatcatcatatccattctgataaagatacagacctacactcgcctaaa
aatggtatctttcaatcacacgtaggctgggtttttgaatctagaagtgatcatgttgat
cctaaatttactaaagactgggttaagctgagctag

DBGET integrated database retrieval system