KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_00400Help
Entry
NE061598_00400    CDS       T01938                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
ftr00020  Citrate cycle (TCA cycle)
ftr00190  Oxidative phosphorylation
ftr00650  Butanoate metabolism
ftr01100  Metabolic pathways
ftr01110  Biosynthesis of secondary metabolites
ftr01120  Microbial metabolism in diverse environments
ftr01130  Biosynthesis of antibiotics
ftr01200  Carbon metabolism
Module
ftr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ftr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ftr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ftr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NE061598_00400
   00650 Butanoate metabolism
    NE061598_00400
  Energy metabolism
   00190 Oxidative phosphorylation
    NE061598_00400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DoxX
Motif
Other DBs
NCBI-ProteinID: ADA77752
Position
74375..74728
Genome map
AA seq 117 aa AA seqDB search
MAVISLTSSGIKDFFVQRVTAVIIAVYFGYLILEALYLSHIGALNYDSWRGLFTDGMFFR
VATLMAYLAMFFHAWVGIWIICGDYIKFAWASALVMLSFVLVYIFCFFWLFAVLFFY
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaatttcattaacttcttctggaattaaagactttttcgtacaaagagttacg
gctgtaattattgctgtatattttggttatcttatcctagaagctttgtatttgtcgcat
ataggagctcttaactatgatagttggagaggtttgtttaccgatgggatgttttttaga
gttgctacgttaatggcgtacttggcgatgttttttcatgcatgggtaggtatctggatt
atatgtggcgattatattaaatttgcttgggcttctgcgcttgtgatgctgagctttgtt
ttggtgtatatattctgctttttttggttatttgcagttttatttttctattaa

DBGET integrated database retrieval system