KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_00435Help
Entry
NE061598_00435    CDS       T01938                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ftr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NE061598_00435
   01230 Biosynthesis of amino acids
    NE061598_00435
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NE061598_00435
   00051 Fructose and mannose metabolism
    NE061598_00435
   00562 Inositol phosphate metabolism
    NE061598_00435
Enzymes [BR:ftr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NE061598_00435
Exosome [BR:ftr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NE061598_00435
  Exosomal proteins of bladder cancer cells
   NE061598_00435
  Exosomal proteins of melanoma cells
   NE061598_00435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
83503..84264
Genome map
AA seq 253 aa AA seqDB search
MQKLIMGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVG
LQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTIT
PVVCIGESLDDRQSGKLKQVLATQLSLILENLSVEQLAKVVIAYEPVWAIGTGVVASLEQ
IQETHQFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKAAEF
NEIINQANKICTE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaataatgggtaactggaaaatgaatggtaactctacaagcataaaagag
ctctgtagtggtatatcacaagtgcaatatgatacttcaagagtagctattgctgttttt
ccatcaagtgtttatgttaaagaagtaatctcacagctgccagagaaagtaggtgttggt
ctacaaaatattactttttatgatgatggtgcttatactggtgagatatctgctaggatg
ttggaagatattggttgtgactacttactaattggtcattctgagagaagatctctattt
gctgagtctgatgaagatgtttttaaaaagcttaacaagattatagatactactataacg
ccagtagtgtgtattggtgaatcactagatgatagacaaagtggtaagctcaaacaagtt
ttagcaacacaactaagcttaatcttagaaaatttatctgttgagcagttagcaaaagtc
gtaattgcatatgaacctgtctgggcaataggcacaggagttgtggcttcactagagcag
attcaagaaacacatcaatttattcgttcattgttagctaaagttgatgaaagacttgct
aaaaatataaaaatagtgtatggtggtagcctaaaagctgaaaatgctaaagatatatta
agcttaccagatgtcgacggtggtttaattggtggcgcatctttgaaggctgctgaattt
aacgaaataataaatcaagcaaacaagatatgtacggaataa

DBGET integrated database retrieval system