KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_00740Help
Entry
NE061598_00740    CDS       T01938                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    NE061598_00740
Enzymes [BR:ftr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     NE061598_00740
Exosome [BR:ftr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NE061598_00740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
142062..143570
Genome map
AA seq 502 aa AA seqDB search
MSKDFILAVDQGTTSSRAIIFDKKGNIRKIAQKEFTQIYPKSGWVEHDAMEIWGTQSGVM
REALEFGRVKPDQIAAIGITNQRETVVVWDKETGDPVYNAIVWQCRRTSSICDEIKRDPQ
FVKYIKENTGLVVDAYFSGTKVKWILDNVEGAREKANAGKLLMGTIDTWLIWNLTRGKVH
ATDYSNASRTMLFNINSLEWDKKILDYLNIPESMLPEVKNSSEVFGVTDSHTLGGAEIPI
AGVAGDQHAALFGHCCFEKGMAKNTYGTGCFALMNVGDKPVYSDEGLLTTIAWAENGKPT
YALEGSVFIAGAVIQWIRDGLGLVRSAEDSEYYATKIDSTNGVYLVPAFVGLGTPYWDMY
ARGTIVGITRDTKREHIIRAALEAIAYQAKDVLECMKEDTGLDLAGLRVDGGAVQNNFLM
QFQSDILQSEISKPKVNEITGLGAVFLAGLAVGFWKDKQELKSILTTEKVFEPQKDSQAV
AHDYRGWKKAVERSKAWAECYS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagatttcatcttagctgtagatcaaggtacaacaagttcacgagcaattatc
tttgataaaaagggtaatataagaaagattgctcaaaaagaattcacacaaatatatcct
aaaagtggttgggtagaacatgatgcaatggaaatatggggtactcaaagtggcgtaatg
cgtgaggcactagagtttggccgcgttaagccagatcaaattgcagcaataggtattaca
aatcagcgcgagacagttgtagtttgggataaagaaacaggtgatcctgtctataatgct
atagtgtggcaatgtcgccgtacttcgagtatttgtgatgaaatcaaacgagatcctcaa
tttgtcaaatatatcaaagaaaatactggtctggttgtagatgcgtatttttcaggcact
aaagtaaaatggattttagataacgttgaaggtgctagagaaaaagcaaatgccggcaaa
ttattaatgggtactatagatacttggttgatttggaatctaactcgcggtaaagtgcat
gcgacagactatagtaatgcttcgcgcactatgttatttaatattaatagtttagagtgg
gataaaaaaatacttgattacttaaatattcctgaatcaatgttacctgaggttaaaaac
tcaagtgaggtttttggagttacagatagccatactttaggtggtgctgagattcctatt
gctggtgttgcaggagatcagcatgcagcattatttggtcattgctgttttgaaaaaggt
atggcaaaaaatacttatggtacgggttgttttgccttgatgaatgtcggcgataagcca
gtttattcagatgaaggtttattgaccactatcgcatgggcagaaaatggtaagccaact
tatgctttagaaggtagtgtatttatagcaggagctgttattcagtggattcgtgatggt
ttgggactagtgcgttctgctgaggatagtgagtactatgctactaagattgattctaca
aatggtgtatatttggtgcctgcgtttgttggtcttggcacaccatattgggatatgtat
gctcgtggtacgatagttggtattacccgcgatacaaagcgtgagcatattattcgtgca
gctctagaggctatagcatatcaagctaaagatgtcttagaatgtatgaaagaggatacg
ggacttgatcttgctggtttgcgtgttgatggtggcgcggtacaaaataacttcctaatg
cagtttcaatctgatattttacaatctgaaatctcaaaaccgaaagtaaatgaaattact
ggtttgggggctgtcttcttagctggtttagcagttggtttttggaaggataaacaagaa
ttgaaatctattcttacaactgaaaaagtttttgaaccgcaaaaagactctcaagctgtt
gctcatgattatagaggttggaagaaagcagtagaaagaagtaaggcttgggcagagtgt
tatagttaa

DBGET integrated database retrieval system