KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_01530Help
Entry
NE061598_01530    CDS       T01938                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
ftr00900  Terpenoid backbone biosynthesis
ftr01100  Metabolic pathways
ftr01110  Biosynthesis of secondary metabolites
ftr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ftr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NE061598_01530
Enzymes [BR:ftr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     NE061598_01530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADA77960
Position
286302..287129
Genome map
AA seq 275 aa AA seqDB search
MANIKAKKYYSYAKINLFLHILNKRPDGYHNLQTWFTFLDLKDQLTFSFNNSREINISSN
ISIAAKQDNLVYKAIKKFQQSYRVQDIGVDIEIKKNIPMGAGLGGGSSNAATTLIALRDY
YLPQLSNEEMIPLAAKLGADVPIFVYGKSAWAEGIGEILYHKDFSPQYALLIKPDIHIST
KEFFTSEDLIKSSVLISKDLGFDKSIMHNDFENVFYAKYPEFSQYLKELDSDFRMTGTGS
CFYLLSADKNKLEQLARKINKPLDKWLVKTLNYVY
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatataaaagctaaaaaatactatagttatgcaaagataaatctatttttgcat
atattaaacaaacgtccagatggttaccataatttacagacttggtttacctttttggac
ttaaaagatcaactaacttttagttttaataattcacgagaaattaatatttcgagtaat
attagtattgctgcaaaacaagataatttagtatataaggctatcaaaaaatttcagcaa
agctatagagtgcaagatataggtgttgatattgaaattaagaaaaatattccaatggga
gcaggacttggcggtggaagctcaaatgctgctactacacttatagctttacgtgattat
tatttgccgcagttgtcaaatgaggagatgattccattagcggcaaaacttggtgccgat
gtgccgatatttgtttatggtaaatctgcgtgggcagaaggtataggtgagatattatac
cataaggattttagtccgcagtatgcgctattgattaaaccggatatccatattagtaca
aaagagttttttacaagtgaggatttaattaagtcatcggttctaatatctaaagattta
ggctttgataagagcattatgcataacgattttgagaatgttttttatgcaaaatatcca
gagtttagtcaatatctaaaagagttagatagtgattttagaatgacaggtacaggttct
tgtttttatttactctcagcagataaaaataaacttgagcaacttgcaagaaaaattaat
aaacctcttgacaaatggctagtcaaaacattaaactatgtctactaa

DBGET integrated database retrieval system