KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_01750Help
Entry
NE061598_01750    CDS       T01938                                 

Definition
dihydrofolate reductase type I
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NE061598_01750
   00670 One carbon pool by folate
    NE061598_01750
Enzymes [BR:ftr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NE061598_01750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(327833..328375)
Genome map
AA seq 180 aa AA seqDB search
MLKYIKMTKNRFLKMISLIVAYDKNFGIGKENTLAWKLSEDLKNFKKITENNYIVMGRKT
FESIGRPLPNRKNIILTRDKDYKQDKCLIINSTQDILNFAESKPHYEIFIIGGAQIYKEF
LKYADRLYITEVDAEMTDLDAFFPQWDKSKYKRIGHKQFKKDDKNEFDFTFSVFEKNKNL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaatacatcaaaatgactaaaaatagatttctcaaaatgatctcactaatcgtt
gcttatgataaaaactttggtataggtaaagaaaatactctagcatggaaactatcagaa
gatcttaagaactttaaaaaaataacagaaaacaactatattgttatgggtagaaaaacc
tttgaatcgattggtcgcccactaccgaatcgtaaaaatattattttaactagagacaaa
gattacaaacaagataaatgtttaataataaatagtactcaggatattttaaattttgct
gaatcaaaaccacactacgaaatatttataatcggtggtgcacagatctataaagaattt
ctaaaatacgcagatagattgtatataaccgaagttgatgcagaaatgactgatcttgat
gctttctttccacaatgggataaatcaaaatataaacgtattggtcacaaacaattcaaa
aaagatgataaaaatgagtttgactttacatttagcgtctttgaaaaaaataaaaatttg
taa

DBGET integrated database retrieval system