KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_02395Help
Entry
NE061598_02395    CDS       T01938                                 

Definition
hypothetical protein
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(444466..444696)
Genome map
AA seq 76 aa AA seqDB search
MYFGVDYYPEQWDYSLINEDLNRIANSELNCIRIAEFAWHLMEPIENEFDFSFFEMILNK
AHKLGLKVMLGTPIAT
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgtattttggtgtcgactattacccagaacaatgggattattctcttattaatgaagat
ttaaatcgtatagcaaattctgagttaaattgtattagaattgctgaatttgcttggcat
ctaatggagcctatagaaaatgaatttgattttagtttctttgaaatgatactaaataaa
gctcataagttaggattaaaagttatgttaggaacccctatagcaacttag

DBGET integrated database retrieval system