KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_02395Help
Entry
NE061598_02395    CDS       T01938                                 

Definition
hypothetical protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ftr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    NE061598_02395
Enzymes [BR:ftr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     NE061598_02395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(444466..444696)
Genome map
AA seq 76 aa AA seqDB search
MYFGVDYYPEQWDYSLINEDLNRIANSELNCIRIAEFAWHLMEPIENEFDFSFFEMILNK
AHKLGLKVMLGTPIAT
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgtattttggtgtcgactattacccagaacaatgggattattctcttattaatgaagat
ttaaatcgtatagcaaattctgagttaaattgtattagaattgctgaatttgcttggcat
ctaatggagcctatagaaaatgaatttgattttagtttctttgaaatgatactaaataaa
gctcataagttaggattaaaagttatgttaggaacccctatagcaacttag

DBGET integrated database retrieval system