KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_02580Help
Entry
NE061598_02580    CDS       T01938                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ftr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
478466..479440
Genome map
AA seq 324 aa AA seqDB search
MSFPISRPRRLRVTQAFRDIVAETTLSLDDLMYPIFVVHGQGVKKEISSMPNQYHWSVDM
LDELVDQVVKAGIRSLMIFGVPKIKDLVSSENYDPNGITQQAIRKIKQLAPELVIATDVC
MCSFTPHGHCGILDEHDYVDNDQTLEILQKTAVSHAQAGADIVAPSGMMDGMIIAMRQAL
DEASFENVSIMSYSVKYASAYYGPFRSACSSSLKGDRKTYQMDYRNKKEAICEALADIEQ
GADFIMVKPALSYLDIVNELSHIIDLPIAAYHVSGEYAMIKAAASAGLVDEKAITIETLI
SMKRAGAKVILTYTALDVANWLKV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagctttccaatatcacgtccacgtagacttagggttacacaagcttttcgcgatatc
gttgctgagacaactttaagccttgatgacttaatgtatccaatatttgttgtgcatggt
caaggagttaaaaaagaaatttcaagtatgccaaatcaatatcattggtcagttgacatg
cttgatgagttagtagatcaagttgtcaaggctggaataaggagtctaatgatatttggc
gtgccaaaaatcaaagatcttgtttcatcggagaattatgatcctaatggaataacacag
caagcaattagaaagattaaacaacttgctcctgagcttgtgatagctacagatgtatgt
atgtgtagttttacaccacatggtcattgtggaattttagatgagcatgattatgttgat
aacgatcaaacattagaaatattacaaaaaacggctgtttctcatgctcaagctggagca
gatattgtagcaccaagtgggatgatggatggtatgataattgcgatgcgtcaggcacta
gatgaggcaagctttgagaatgtgagtattatgtcatactcagttaaatatgcatcggca
tattatggaccatttagaagtgcttgtagttcgtcacttaagggagatcgtaaaacttat
cagatggattatcgcaataagaaagaggcaatctgtgaggcgcttgcagatattgagcag
ggtgcagattttattatggttaaaccagctttgagttatctggatattgtcaatgagtta
agtcatattatagatttaccaatagcagcatatcatgtcagtggtgaatatgcgatgata
aaagctgctgctagtgctggtttagttgatgaaaaagcaatcactatagaaacactcata
tcaatgaaaagagcaggtgctaaagtgatacttacatatactgcgttggatgtggctaat
tggttaaaggtttaa

DBGET integrated database retrieval system