KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_04185Help
Entry
NE061598_04185    CDS       T01938                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ftr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NE061598_04185
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NE061598_04185
Enzymes [BR:ftr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NE061598_04185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
755223..755693
Genome map
AA seq 156 aa AA seqDB search
MSIYDFKLTANDGSEYHLPKNKVLLIVNVASKCGFTKQYRGLQHLHKIYPDLEIVAFPCN
SFGGQEPGSDEEIKNFCETNYNVTFPIMKKTKVNGKDAEPLFEYLKERAKGVLGTEAIKW
NFTKFLVSKDGETIVRYAPKTIPEDLIPDIDNFLKD
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttatgactttaagctaactgcaaatgatggttcagaatatcatctgcctaaa
aataaagtgcttttgatagttaatgttgcgagtaagtgcggttttactaagcagtataga
ggtttgcaacatttacataaaatatatccagatttagaaattgttgcattcccttgtaat
tcatttggtggacaggagccaggtagtgacgaagaaatcaagaatttctgtgaaactaat
tataatgtcacatttccaattatgaaaaaaaccaaagtaaatggtaaagatgctgagcca
ttgtttgagtatctcaaagaaagagcaaaaggagtcttaggaactgaagctataaagtgg
aattttactaagtttttagtatcaaaagatggcgagaccatcgtaagatatgcacctaaa
actattccagaagatttaattccagatattgataattttctaaaagactaa

DBGET integrated database retrieval system