KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_04345Help
Entry
NE061598_04345    CDS       T01938                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ftr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NE061598_04345
   00052 Galactose metabolism
    NE061598_04345
   00500 Starch and sucrose metabolism
    NE061598_04345
   00520 Amino sugar and nucleotide sugar metabolism
    NE061598_04345
Enzymes [BR:ftr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NE061598_04345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
776981..777844
Genome map
AA seq 287 aa AA seqDB search
MKIRKAVFPVAGWGTRFLPATKSCPKEMLTVVDKPLIQYAVEEAIEAGCKEIIFVTSSNK
KSLEDHFDRNFELEYSLEKKQKYELLDLVKNIIPKDVSFFFVRQPEALGLGHAVLCAKPL
VGIEDFAVILPDDLIYNHDCGTGTLKQMVKAVEGTDIRGCIATQQVKREKTNSYGIVAKD
NDNLIKAIVEKPAPEKAPSTNAVVGRYLLPNKIFRCLESTSEGAGGEIQLTDAIAKLLDQ
DEKILSYEFKGTRYDCGSKLGFLIANYEIALQHQELGHKFKEYLQNR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagaaaagcagtttttcctgtagctggatggggcactagatttttaccagct
actaaatcatgtcctaaagaaatgctaacagttgttgataaaccattgatccaatatgct
gttgaagaggctatagaggcaggctgtaaagagataatatttgttactagctcaaataaa
aaatccctagaagatcattttgatagaaactttgaattagaatattcgctagaaaaaaaa
caaaaatatgaattgttagatttagtaaaaaatataattcctaaagatgtaagttttttc
tttgtacgtcagccagaggcgctaggactagggcatgcggttttatgtgcaaaaccacta
gttggaattgaggattttgcagttatattacctgatgatttaatttacaatcatgattgt
ggtactggtacgctaaagcaaatggttaaggcggtagaaggtactgatattagaggttgt
atcgcaactcaacaagtcaagagagaaaaaacaaattcatatggtatagttgcaaaagat
aatgataatctaatcaaagcaattgttgaaaagccagcaccagaaaaagcaccatcaact
aatgcagttgtgggtagatatttattaccaaataagatttttagatgtttagaatcaact
tcagagggcgcaggtggtgagattcaactaactgatgctatcgctaaattattagatcag
gatgagaaaattttgtcttatgaatttaagggtactcgttatgattgtggcagtaaatta
ggttttttaattgctaattatgagatagctttacagcatcaagagttaggacataaattc
aaagaataccttcaaaatagatag

DBGET integrated database retrieval system