KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_04355Help
Entry
NE061598_04355    CDS       T01938                                 

Definition
acyl-coenzyme A synthetase/AMP-(fatty) acid ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ftr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NE061598_04355
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NE061598_04355
   00620 Pyruvate metabolism
    NE061598_04355
   00640 Propanoate metabolism
    NE061598_04355
  Energy metabolism
   00680 Methane metabolism
    NE061598_04355
Enzymes [BR:ftr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NE061598_04355
Lipid biosynthesis proteins [BR:ftr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NE061598_04355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
778433..779305
Genome map
AA seq 290 aa AA seqDB search
MIRSLLKVGDEFLANTRRNSLRVLGSVGEPINPEAWNWFVEKAGNNQAPLVDTWWQTETG
AHMITPLPGAHKLKPGSASKPFFGVEVALLDTDGKEITGVGKGALCIKRATPGMARTIYG
DHDRYLQTYFSSFNGYYFSGDAARRDEDGYIWIEGRMDDVINVSGHRMATAEIEAALNTH
PDVAESAVVGMPHEIKGEAIYVYCILKEGKSDSKEALDEVRKSLIKYVRQEIGPVATPEV
IQFTPELPKTRSGKIMRRILRKIAAKDFENFGDTSTLLNPDIVEYLIKNR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
ttgataagatctttattaaaggttggtgatgaattcttagcgaatactcggagaaattcg
ttaagggtattaggttcagttggtgaaccaataaatccagaggcttggaattggtttgtt
gaaaaagctggtaataatcaggcgccacttgtagatacatggtggcaaactgagacaggt
gcacatatgataactccactacctggtgcacataaacttaagcctggttcggcttctaaa
cctttctttggcgttgaagtagcattacttgatactgatggtaaggagataacaggggtt
ggtaaaggtgctttatgtataaaaagagcaacacctggtatggcacggacaatttatggt
gaccatgatagatatcttcaaacttatttttctagttttaatggttattatttttcaggt
gatgccgcgcgaagagatgaggatggttatatttggatcgaagggcgtatggatgatgtt
attaatgtctcagggcatagaatggcaactgcagagattgaagcagcgctaaatactcat
ccagatgttgcagagagtgcagttgttggtatgccacatgagattaaaggtgaggctatt
tatgtttactgtattcttaaagaaggtaaaagtgattctaaagaggctttagatgaagtt
agaaaatctctgataaaatatgtcagacaagaaataggtcctgttgcgactccagaagtt
atccaatttactccagaattaccaaaaactcgttcaggcaaaattatgcgtcgaatctta
agaaaaatagctgcaaaagatttcgaaaattttggtgatacctctacactattaaatcca
gatatagtagagtatctgataaaaaatagataa

DBGET integrated database retrieval system