KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_05315Help
Entry
NE061598_05315    CDS       T01938                                 

Definition
beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ftr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NE061598_05315
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    NE061598_05315
Enzymes [BR:ftr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NE061598_05315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(939465..941132)
Genome map
AA seq 555 aa AA seqDB search
MSTNSNIRQKLGQLIMMDFRYWGEDSNNQRIPFTKTNDIVNKIFKDYNLGGFILFRENIQ
NNEQVISLLRDLQANTNTPIFFATDQEGGRVNRLQQGISGCGNMALAATDNPHNAYTMAK
IIGDELYSLGININFAPAVDVNSNKNNPIIGVRSYSDNPDIVIDYAKNAINGYHDAKIID
CIKHFPGHGDTATDSHLGNVNLDKTLKELQTTELLPFSKLARDCSMIMTAHISVPALDDT
QYQSVSTSENIYVPATLSYKIITKLLKQQMKFDGLVVSDAMDMHAIAKHFGTIEASKLAI
LAGIDILLMPVRVWSENDLYKLEELFCELEKGYNQNSNFANAVDNVYTNITDFKAKHKLD
ESLIFKLSQDEQLKYANQIVNSNKHQQIALDIAKQSTTVVKNSGIIPCDLNKLKNILIVD
SDNQRLADFHSELQKIVLDNNSNVIINCENINNHNIKTIIENADLILLISANLREYNQTY
SYITSIKPEQTINIAALTPYDINYIDNIINYVCIYGATSMDYTNYTKTSLKINIQTTLEN
IFGNKEIKGVLPVSL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaaactcaaatataagacaaaaactaggtcaactaattatgatggattttcgc
tattggggtgaagattcaaataatcagcgtataccttttacaaaaactaatgatatcgtc
aataagatctttaaagactataatttaggtggttttatcctttttagagagaatattcaa
aataatgagcaagttatctctctattaagagatcttcaagctaacaccaatacaccaata
tttttcgctacagatcaagaaggtggcagagttaatcgcttacaacaaggtattagtggt
tgcggtaatatggcactagctgcaacagataatcctcataatgcctatactatggctaaa
ataattggcgatgaattatattctttaggtatcaatattaattttgctccagctgtggat
gttaactctaacaaaaataatcctattattggtgtaagatcatactcagataatcctgat
atagttattgactacgccaaaaatgctataaatggttatcatgatgcaaaaattatagac
tgcattaaacatttccctggtcatggtgatactgcaacagatagtcatttaggcaatgta
aacttagataaaactttgaaagaattacagacaacagagctactaccctttagtaaactt
gctagagattgtagtatgataatgacagcacatattagtgtaccagccctagatgacacc
cagtatcaatcagtttcaacaagtgagaatatttatgtgccagccaccctctcttataaa
ataataactaaattactaaaacaacaaatgaaatttgatggtttagtagtatctgatgcc
atggacatgcatgctattgctaaacactttggaactattgaggcttctaaattagctatc
ttagctggtatagatattttattaatgcctgttcgagtatggtcagaaaatgatctttat
aaattagaagagcttttttgtgaactagaaaaaggatataatcaaaattctaattttgct
aatgcagttgataatgtctatacgaatattactgatttcaaagcaaaacataaactcgat
gaaagtttaatattcaagctctcacaagatgagcaattaaaatatgctaatcaaatagtt
aactctaataaacatcaacaaatagctttagatattgctaaacaaagtacaactgtagtt
aaaaattcaggtattattccatgcgatctcaataagctaaaaaatatcttgattgtagat
agtgataaccaacgcttagcggattttcatagcgagttgcagaaaatagtattagacaat
aactcaaatgttattattaactgcgaaaatattaataaccataatattaaaactattatc
gaaaatgccgatctgatcctattaatttcagcgaatcttcgtgaatataatcagacctat
agttatataacttctataaagccagagcaaactataaatatagcagcacttactccttat
gatattaattatatagataatattattaattatgtttgtatttatggtgcaacttctatg
gattatacaaactatacaaagacttcactaaagattaatattcaaacaacattagaaaat
atttttggtaataaagagattaaaggagtactaccagtcagtttataa

DBGET integrated database retrieval system