KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_07730Help
Entry
NE061598_07730    CDS       T01938                                 

Definition
Exodeoxyribonuclease V, alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ftr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NE061598_07730
Enzymes [BR:ftr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     NE061598_07730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1369730..1371571)
Genome map
AA seq 613 aa AA seqDB search
MYKTFHKACEQLADIRAIDFFFAKEVFGLVKKTTPSMTTLSSESYPPFHGAKGNDLEQKS
NEILFHILMKLMHVYSHGHSCLKIADISNKTIFASEQSNQSDAKVGFKMPSSDKIASILD
NLNYDNLPIYFAKQYDSLYIKRLWNYENEIANFIKLKTIQNTQKDNRIEEVVDKLFEPAG
EINWQKQAVIKSLNYNFSIISGGPGTGKTTTVAKLLLAIQMLNQNQQRIALLAPTGKAAQ
RMTESLKNTLATVIPSSLTTESTIQKNDIFKQVQDELNSVAQYLNNLEAQTIHRFLGLRP
NSTYVKYNQQSKAPFDVIIVDEASMLDMNIFIKLIRAVADNTKLILIGDTNQLPSVEAGS
LLANFTHDKYGSITPYTTLLIKNYRSQQYINNLAASVLKGDVNIDSQQNENIKFHSLRNL
DIYLREYAKRYSQLEKCRDYKEALTELNKFRILVANKNLEIGTDKLNQKIEKFMSKPIDS
NYKGKLIMITQNSYSLGLFNGDVGIMWPDDTGKLRAYFDGKDAKAFSLNMLPKYESVYAM
TIHKTQGSEFDEIVIILPAEDNEALSKQLLYTAITRAKYKLTIISEQSSLRDIAQKDIKR
NSNISELVSLSTQ
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaactttccataaagcttgtgagcaattagcagatattagagccatagatttt
ttctttgctaaagaggtgtttggtttagtcaaaaagactactccgtctatgaccacttta
tcaagtgagtcatatccaccctttcacggagcaaaggggaatgatttggaacaaaaaagt
aatgaaattttatttcatattttgatgaagcttatgcatgtgtatagtcatggtcatagc
tgtttgaagatagcagatatatcaaataaaactatttttgcttcagagcaaagtaatcag
agtgatgctaaagtaggctttaaaatgccaagctctgataaaattgcaagtattttagat
aacttaaattacgataatttacctatatattttgccaaacagtatgattctttgtatatt
aaaagattgtggaattatgaaaatgaaatagctaactttataaaattaaaaacaatccaa
aatactcaaaaagacaatcgtattgaagaagttgtagacaaactatttgaacctgctggt
gaaatcaactggcaaaaacaggcggttatcaaaagtctaaattataattttagtattatc
tcaggtggacctggtacaggtaagacaaccacagtcgcaaagcttttacttgctatacaa
atgcttaatcaaaatcagcaaagaatagcgcttttagcaccaactggtaaggctgctcag
agaatgacagagtcattaaaaaatactctagcaactgtcattccgtcaagcttgaccaca
gaatctactatacaaaaaaatgatatctttaaacaagttcaggatgaacttaatagtgtt
gctcagtatcttaataatctagaagcacaaactatacacagatttttaggcttaagacca
aactctacttatgttaaatataaccaacaatctaaagctccattcgatgttattattgtt
gatgaagcttcgatgcttgatatgaatatttttatcaagttaattagagctgtagcagat
aatactaagttgatattaataggtgatactaatcagttaccatctgttgaggctgggagt
cttttagcaaactttacacatgataaatatggtagcattacgccatatacaacattactt
atcaaaaactatcgttcacaacaatatataaataatcttgcagcctcagtcctaaaaggc
gatgttaatattgatagtcaacaaaatgaaaatattaaatttcatagtctaagaaattta
gatatttatttaagagagtatgcaaagagatattcacagcttgaaaagtgccgtgactac
aaagaggctcttacagagctgaataaatttagaatacttgtggctaacaaaaacctagaa
attggtacagataagttaaatcagaaaattgagaagtttatgtctaagcctatagattct
aactataagggtaaactaattatgataactcaaaatagttattcattagggttatttaat
ggagatgtagggattatgtggcctgatgatactggtaagctccgagcatattttgatggt
aaagatgctaaggcatttagtctaaatatgctaccaaaatatgaaagtgtttatgcgatg
acaattcataaaactcaaggctcagagtttgatgaaatcgtgattattcttccagcagaa
gataatgaagcgctaagtaaacaacttttgtatacagctattactagagcaaaatataaa
ttaacgattatatctgaacaaagtagcttaagagatattgctcagaaagatattaagaga
aattcaaatatcagtgaattagttagcttgagcactcaataa

DBGET integrated database retrieval system