KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_08215Help
Entry
NE061598_08215    CDS       T01938                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
ftr00230  Purine metabolism
ftr01100  Metabolic pathways
Module
ftr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ftr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NE061598_08215
Enzymes [BR:ftr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NE061598_08215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_23 AAA_22 MMR_HSR1 AAA_16 AAA_18 DUF4921 RsgA_GTPase ABC_tran AAA_29
Motif
Other DBs
NCBI-ProteinID: ADA79114
Position
complement(1454595..1455167)
Genome map
AA seq 190 aa AA seqDB search
MNNYIFIVSAPSGAGKSSLLKAFLATDIGKDNYAVAISHTTREPRVGEINSREYYFVTVA
EFEQLLSQDGFIEYAKVFKNYYGTSKAELDRLLALGKNIILEIDWQGAQQTRAIYGDRAK
SIFILPPSLDELRKRLEKRNTDSKETIDYRMEQAQSEISHADEYDYLLVNDDFSQSLEQF
CKYFEQNIQS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaataactatatttttatagtttctgcaccatctggcgcgggtaaaagttctttacta
aaagcttttttagcaactgacataggcaaggataactacgctgtagcaatctcccacact
actagagagccacgtgttggcgagatcaatagtagagaatattattttgtcacagtagct
gaatttgaacaattacttagtcaagatggctttattgaatatgctaaagttttcaaaaac
tattatggtacatctaaagctgagcttgatagattgcttgcattaggtaagaatattatc
cttgagattgactggcaaggtgcacaacaaacacgtgctatttatggcgatagggctaag
agtatatttatattaccgccttctttagatgagttaagaaaacgtctagaaaaaagaaat
acagattctaaggagactatagattatcgtatggagcaagcacaatcagagatttcacat
gctgatgaatatgattatctgctggttaacgatgattttagccagtcattagaacaattc
tgtaaatatttcgaacaaaatatccaaagttaa

DBGET integrated database retrieval system