KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_08710Help
Entry
NE061598_08710    CDS       T01938                                 

Definition
Delta 9 acyl-lipid fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ftr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NE061598_08710
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    NE061598_08710
Enzymes [BR:ftr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     NE061598_08710
Lipid biosynthesis proteins [BR:ftr01004]
 Desaturase
  First
   NE061598_08710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1545968..1546795
Genome map
AA seq 275 aa AA seqDB search
METQSNKLTIVAFAIMHLACLAIFFVNYNITALVVFVVTFSARTFALTAGYHRYFAHKAF
QTSRVFQFILALVGTWASQKGPLWWSGHHRYHHIHSDKDTDLHSPKNGIFQSHVGWVFES
RSDHVDPKFTKDWVKYPELVWIDKYAHVSFALYLVGLFALGSLISHFYPSLETSGLAFVF
WGGILSTVLLYHTTFSVNSICHIFGSKDYETDNSCNNWFIALITFGEGWHNNHHKFAYSV
RNNLKVWQIDITYMILCVLRKFRIVWDFKQPKKTI
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacagtctaataaattgacaatagtagcatttgctattatgcacttagcctgc
ttggcaatattttttgtaaattataatattacagctctagttgtatttgttgttacattc
tcagctagaacatttgctttgacagctggataccatcgttactttgcacacaaagctttt
caaacctctagagtgtttcaatttatcttagcgttagtaggtacttgggcatcgcaaaaa
ggaccgctttggtggtcaggacatcatagatatcatcatatccattctgataaagataca
gacctacactcgcctaaaaatggtatctttcaatcacacgtaggctgggtttttgaatct
agaagtgatcatgttgatcctaaatttactaaagactgggttaagtatcctgagctagta
tggatagataaatatgctcatgtatcatttgctctatatctggtagggctttttgcttta
gggagcctaattagccacttttatccaagccttgaaacatctggactagcatttgtcttc
tggggagggatattaagtaccgtcttactatatcatactacttttagtgtaaactcaatt
tgccatatctttggatctaaagattacgaaacagataatagctgcaacaattggtttata
gctctaattacatttggtgaaggttggcataataatcatcataaatttgcttattcggtt
agaaataatcttaaagtatggcaaatagacattacctatatgattttatgcgtcttgaga
aagttcagaatagtttgggattttaagcaaccgaagaaaactatttag

DBGET integrated database retrieval system