KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_09375Help
Entry
NE061598_09375    CDS       T01938                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ftr00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ftr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1666458..1667378
Genome map
AA seq 306 aa AA seqDB search
MLSFQKLLRGDQITKDDLFKLFHQADIYKNKLANSEPIKDLEGKILASLFFEPSTRTRFS
FESAMNRLGGKVISLENGSSSSTQKGETLDDTGRMIDQYADIIVMRHPKPHSVEEFSKYV
NSPVINAGDGENEHPTQSLVDLYTIYSEKGSLDNLKVGFLGDLKYGRTVHSLTNILAKYN
ASFKFISSKELQIPKKLKDFIIKNGNSFIELDKVSADVLEDLDVLYVTRVQRERFPDEES
YLKNKDLCYLDRKHISPRSNFIILHPLPRVDEMDRSIDELECAKYFEQIKYSIPIRMTLL
ALLVIS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgctatcatttcaaaagttactacgcggtgatcaaattactaaagatgatttgtttaaa
ctatttcatcaagctgatatttataaaaataaactagctaattcagagcctatcaaagat
ttagaaggcaaaatattagcatctcttttctttgaaccaagcactagaactagattctct
tttgaatctgctatgaatagacttggtggtaaagtaatatcactagaaaatggctcatca
agctcaacacaaaaaggtgaaacccttgatgatacaggtagaatgattgatcaatatgct
gatattatcgtgatgcgtcaccctaaaccacatagtgttgaagagttctctaaatatgtc
aactctcctgtgataaatgctggcgatggtgaaaatgaacatcccactcagtcattggtt
gacttatatactatctactctgagaaaggctctcttgataatctaaaagttggtttctta
ggagatctaaaatatggtcgtacggttcactcactaaccaatatccttgctaaatataac
gcctcgtttaaatttatatcttcaaaagagctacagattcctaagaaactaaaagatttt
atcatcaaaaatggcaactcttttattgagttagataaagttagtgccgatgttttagaa
gacttagatgtactatatgtaactcgcgtccagagagaaaggtttcctgatgaagaaagc
tatctaaaaaataaagatttatgctatttagatagaaagcatatttcccctagaagtaat
tttataattcttcatcctctacctagagttgatgagatggatagatctattgatgagctt
gagtgtgcgaaatattttgagcaaatcaaatatagtattccgattaggatgacgctattg
gctttattagtaatatcctaa

DBGET integrated database retrieval system