KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_10290Help
Entry
NE061598_10290    CDS       T01938                                 

Gene name
purT
Definition
phosphoribosylglycinamide formyltransferase 2
Orthology
K08289  
phosphoribosylglycinamide formyltransferase 2 [EC:2.1.2.2]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ftr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NE061598_10290 (purT)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NE061598_10290 (purT)
Enzymes [BR:ftr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     NE061598_10290 (purT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1854004..1855140)
Genome map
AA seq 378 aa AA seqDB search
MLLGSGELGKEFIIAAQRLGIHTIVVDRYKNAPAMQVAHESYVIDMLNSDALEQLILAKN
PTYIVPEIEAINTDSLVKLEAHNFNIIPCAKAAKLTMDRQGIRALAAQQLNLQTSKFAFA
NSEQEYLDVIQSIGLPFVIKPVMSSSGKGQSIVKEHNEIKKAWDYAQNGSRGHAKGVIVE
QFIDFDYEITLLTVRHKDGTSFCDPIGHIQKDGDYRFSWQPHTMPDTALAKSQEIAKEIT
DALGGYGVFGVELFIKGDEVFFNEVSPRPHDTGMVTLISQNINEFELHLRAIVGLPIPDI
QTLQPSASAAILLEGDTANASICGIDKALADANVDIRIFGKKEIHGKRRMGVVLAKAQNT
HIALETSKQALAHIHLTK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgttgcttggttcaggtgaactaggcaaagaattcataatagctgctcaaagacttggt
atacacactatagttgtagatcgatataaaaatgcaccagctatgcaagtagctcacgaa
agctatgttatagatatgctaaattcagatgctcttgagcaactaattctagcaaaaaat
ccaacgtatatagttcctgaaattgaagctataaataccgatagcttagtaaaactagaa
gctcataacttcaatattatcccatgtgcaaaagccgcgaaactaactatggatcgccag
ggtataagagctttagctgcacaacagcttaatttacaaacatcaaaatttgcatttgca
aatagcgagcaggaatatctagatgtaatacaatcgattggtctaccatttgtgattaag
cctgtaatgagctcttcaggtaaaggtcaatcaattgttaaagaacataatgaaattaaa
aaagcttgggattatgctcaaaatggctctcgaggccatgctaaaggtgtaattgtagaa
caatttatagattttgactatgagataacgctactaactgttagacataaagatggtact
tcattttgcgaccctattggacatatccaaaaagatggtgattatcgcttctcttggcaa
cctcatacaatgccagatacggctttagcaaagtcacaagaaattgctaaagaaatcacc
gatgcattaggtggctatggagtttttggagttgagttattcataaaaggtgatgaggta
ttttttaatgaagtctcacctcgtcctcatgacacggggatggtgacacttatatctcaa
aatatcaacgaatttgagctacatcttcgtgcaatagttggactacctatacctgatata
cagacattacagccatctgcttctgcagcaatattacttgaaggagatactgctaacgca
agtatttgcggtattgataaagcattagctgatgcaaatgtagatataagaatatttggc
aaaaaagaaatacatggtaaacgccgtatgggagttgtcttagcaaaagcacaaaatact
cacatagctttagaaacttctaagcaagctctagcacatattcatcttactaaataa

DBGET integrated database retrieval system