KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_10325Help
Entry
NE061598_10325    CDS       T01938                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ftr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NE061598_10325 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NE061598_10325 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NE061598_10325 (trpA)
Enzymes [BR:ftr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NE061598_10325 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1861666..1862475)
Genome map
AA seq 269 aa AA seqDB search
MTNRYTTLFANLEKRNEGAFIPFVTIGDPNKALSFEIIDTLVSSGADALELGIPFSDPLA
DGPTIQEANIRALESGITPKDCFDILTKIRAKYPHIPIGLLLYANLVYANGIENFYQKCL
DAGVDSILIADVPAHESKEFRDIAKKVGIAQIFIAPPDASESTLKQISELGSGYTYLLSR
VGVTGTETAANMPVEDVLTKLREYNAPKPVLGFGISKPEQVQQAIKAGAAGAISGSATVK
IIQNNISNKQKMLNELTYFVKEMKAATLN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatagatacacaaccctttttgcaaatttagagaaaagaaatgaaggagctttt
ataccttttgtaacaattggtgatcctaataaagcgctatcctttgaaattatcgatact
ttggttagttcaggtgctgatgctcttgagttgggtatacctttttcagatcccttagca
gatgggccaacaattcaagaagcaaatattcgcgctctggagagtggaataacccctaaa
gattgtttcgatattctaactaaaataagagcaaaataccctcatatccctattggttta
ctactttatgctaatttagtctatgcaaacggtatagagaacttttatcaaaaatgttta
gatgcaggtgttgattctatacttatagctgatgtacccgctcacgaatctaaagagttt
cgtgatattgctaaaaaagttggtatagcacaaatatttatcgctcctcctgatgctagt
gagtcaactcttaagcaaatttctgaacttggtagtggttatacgtatttactatcgaga
gttggtgtaacagggacagaaactgctgcaaatatgcccgtcgaggatgtattgactaaa
cttagagaatataatgctcctaaaccagttttagggtttggtatctctaaacctgagcaa
gtacaacaagctatcaaagctggtgctgctggtgcaatttcaggctcagcaacagtgaaa
attattcaaaataatatctctaataaacaaaaaatgcttaatgagcttacatattttgtt
aaagagatgaaagcagctacattaaactaa

DBGET integrated database retrieval system