KEGG   Francisella tularensis subsp. holarctica F92: F92_02695Help
Entry
F92_02695         CDS       T02349                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
fts  Francisella tularensis subsp. holarctica F92
Pathway
fts00260  Glycine, serine and threonine metabolism
fts00750  Vitamin B6 metabolism
fts01100  Metabolic pathways
fts01110  Biosynthesis of secondary metabolites
fts01120  Microbial metabolism in diverse environments
fts01230  Biosynthesis of amino acids
Module
fts_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fts00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    F92_02695
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    F92_02695
Enzymes [BR:fts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     F92_02695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N IL6
Motif
Other DBs
NCBI-ProteinID: AFX70202
Position
480791..482083
Genome map
AA seq 430 aa AA seqDB search
MNFISTRDKNIKVSLSEAMQSGLALDGGLFVPERFPTVNWQSFAKDISYAKFAANTLREF
FKGDQLEDSLDKICNNAFTFEAPVRRLDKTTSVLELFHGPTLSFKDFGARFLANCLSSID
SEKPFTILVATSGDTGSAVAAAFHGKSNIRVIVMFPKGKISKRQEKQITCWGDNIQAVEV
EVEGVFDDCQSLVKEAFKTPWWTERTKLNTSNSINIGRLLSQSTYYAYTSWQHYLQTGEK
ANYIVPSGNIGNITAAFWAKQMGFPIGEISMSLNANDTVVDYLETGKFNPKASVETLANA
MDVGNPSNFERLLYLLGNYENFKANVKAICVSDFEIIEEIKQVYRQYHEVVCPHTATGFV
AKNQLDSNKDYIIVATAHPAKFESVIEPILDIQVPPTPALQKLLDKEQNKVVINKSMDEL
CEVYTKAFEA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaattttattagtactagagataaaaatattaaagtttcactaagtgaagcgatgcag
tctggattagctcttgatggaggattatttgtcccagagagatttcctacagttaattgg
cagagttttgctaaagatatcagttacgcgaagtttgctgctaatactctaagagaattc
tttaaaggagatcagctagaagactctttagataaaatttgtaataatgcttttactttt
gaggctcctgtaagaagattagataaaaccacatcagttttagagctttttcatggtcca
actttatcttttaaagatttcggtgcgagatttttagcaaactgtttaagctctatcgat
agtgagaagccatttactattttagtggcaacttctggagatacaggttcagcagtagct
gcagcttttcatggtaagagcaatatccgtgttatagtgatgtttcctaaaggtaaaatc
tctaaaagacaagaaaagcagataacttgttggggagataatatccaagcagttgaagtt
gaagttgaaggagtttttgatgactgtcaaagtctagtcaaagaagcttttaagacacct
tggtggacagagaggactaagttaaatacatcaaatagtattaatatcggtagattacta
tcacaatcaacttattatgcttatacatcgtggcaacattatttgcagaccggagagaaa
gcaaactatatagttccatctggcaatattggtaatataactgctgctttttgggcaaag
caaatgggctttccaataggtgaaatatcgatgagtttaaatgctaatgatactgttgtt
gactatctagagactggtaagtttaatcctaaggcaagtgttgaaacgctagcaaatgct
atggatgttggtaaccctagtaattttgaaagattgttatacttgttgggtaattatgaa
aatttcaaagctaatgttaaggctatatgtgtttctgactttgaaattatagaagaaata
aaacaagtgtatcgtcaatatcatgaagttgtttgtccacacacagcaacaggttttgta
gcaaaaaatcagttagatagcaataaagattatataatcgtagcaactgcacatcctgct
aagtttgaaagtgtaattgagcctatattagatatacaagtgccgcctacaccggcgtta
caaaagctactagacaaagagcaaaataaagtagttataaataagtctatggatgagctg
tgcgaggtttatacaaaagcttttgaagcttag

DBGET integrated database retrieval system