KEGG   Francisella tularensis subsp. holarctica F92: F92_02920Help
Entry
F92_02920         CDS       T02349                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
fts  Francisella tularensis subsp. holarctica F92
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:fts00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
514504..515661
Genome map
AA seq 385 aa AA seqDB search
MFKKTKITILGATGSIGDSTLAVIRETNDFEVFALTAFSNVEKLAELCQEFKPKFAVVPD
LSKKQKLQSLVTDVEVLVGESGLEKVSSLAEIDIVMSAIVGIAGLKPTFAAAKAGKKILL
ANKESLVTAGHLLIDEVVKNNAQLIPVDSEHNAIFQCIDNHDKKCLPEIDKIILTASGGP
FRDKQLHELTDVTPEQACNHPNWQMGRKISVDSSTMVNKALEVIEAYWLFSVSADKIGVL
IHPQSVTHSIVRYVDGSYIAQLGVPDMKTPIANAMYYPKRGSVNVESLDFTKYQLTFREA
CFERFEALKIVFNNLQNKNYAANIVFNAANEELVAAFLNKKIKYLEIIEVNKKVTKELNF
ENPKNIEEVFEIDRKTREYVDSVLG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaactaagattactatattaggagctacaggatctataggtgatagcact
ttagctgttattagagagactaatgattttgaagtttttgcattaactgcatttagtaat
gttgaaaagctggcagagctatgtcaagagtttaagcctaaatttgctgtagttccagac
ttgtcaaaaaaacaaaagttacaatcattagttactgatgttgaggttttggttggtgaa
agtgggcttgaaaaagtatctagcttagctgaaattgatattgtcatgtctgctatagtt
ggtatagcagggttaaaaccaacctttgcagcagctaaagctggtaagaaaattttgctt
gctaataaagaatctttggtaacagcaggacacttgctgatagatgaggttgtaaagaat
aatgctcaacttattcctgtggatagtgaacataatgctatatttcagtgtattgataat
catgataagaagtgtttgccagagattgataagataattttaacagcatctggaggtcct
tttagagacaaacaactacatgagttaacggatgtaacacccgagcaagcatgcaatcat
cctaattggcaaatgggcagaaaaatatcggttgattcatcaactatggtaaataaagcg
ttagaagttatcgaagcgtattggcttttttctgtttcagctgataaaataggcgttctg
attcatccacagagtgtaactcattctattgtcagatatgttgatggtagctatatagcg
cagttaggtgtgcctgatatgaaaacacctatagccaacgcaatgtactatccaaagaga
ggatcagttaacgttgagagcttagattttacaaaatatcagctaaccttcagagaagct
tgttttgaaagatttgaagctttgaaaatagtttttaataatttacaaaataaaaattat
gctgctaacatagtttttaatgctgctaatgaggagcttgtggctgcatttttaaacaaa
aaaattaaatatttagagataatagaagtaaacaaaaaagtaacaaaagagttaaatttt
gagaatccaaaaaatatagaagaagtttttgaaatagatagaaaaactcgtgaatatgtg
gattctgttttggggtaa

DBGET integrated database retrieval system