KEGG   Francisella tularensis subsp. holarctica F92: F92_02965Help
Entry
F92_02965         CDS       T02349                                 

Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
fts  Francisella tularensis subsp. holarctica F92
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fts00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    F92_02965
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    F92_02965
Enzymes [BR:fts01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     F92_02965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
523664..524707
Genome map
AA seq 347 aa AA seqDB search
MLIVGFFGQAIDEKSEIVQHIKDNNIGGVILFDRKDKDNIKSPEQLKTLNSDLQKYTKIY
NDLYMRPQVPLIIAIDYEGGKVNRLKTKYGFPETFTAKKFSELDIQEQAHVAREMAKTMY
KVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKATEKYKIGSVLKHFP
GHGSSTNDSHLGDADITNTWTEKELIPYIRLLPENKHCMVMTAHVMNRNIDETNPATLSN
KIIKILRTDIKFDGVIISDAMEMKAVTEYYGELESLKLAINAGVNIFIFSDGNPDTIIDN
IAKLVESGEVAEATIKQSYENIVTYKQNYLTEETISNNISKCCCNYL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgttgattgtaggtttcttcggtcaagcaattgacgaaaaatcggaaattgttcaacat
attaaagataataatatcggtggtgtaatattgtttgatagaaaagacaaggacaacata
aaaagtccagaacagttaaagactttaaatagcgacttacagaaatatactaagatttat
aatgatttatatatgcgtccacaggtaccattaataattgctattgactatgaaggcggt
aaagtaaatcgattgaaaacaaaatatggatttcctgaaacttttactgcaaaaaaattt
tcagagctagatatacaagaacaagctcatgttgctagggaaatggctaaaaccatgtat
aaggtaggaattaatttaaatttagccccttgtgtagacattcacaacgataattgcccc
gttattggtaaatatgagcgtagtttttctactgatgttaatactattgtagattgtgct
aatcttttttgtaaagctactgaaaaatataaaataggttctgtattaaaacacttccct
ggacatggcagctctactaatgactctcatttaggtgatgctgatattactaacacatgg
acagaaaaagaacttattccatatataaggttattaccagaaaataagcattgtatggtt
atgactgcacatgttatgaacagaaacatcgatgaaactaatccagcaacactgtctaat
aaaataattaaaatattaagaacagatattaaattcgatggagttataatctcagatgct
atggaaatgaaggctgtgacagaatattatggagaattagagtcattgaaactagctatt
aatgcgggtgttaatatatttatattcagtgacggtaatccagatactataatagataat
atcgcaaaacttgtagaatccggagaggttgcagaagcaacgataaaacaatcatatgag
aatattgtgacctataagcagaactatttgacagaagaaacaatatcaaataacattagt
aagtgttgttgtaactatttatga

DBGET integrated database retrieval system