KEGG   Francisella tularensis subsp. holarctica F92: F92_03660Help
Entry
F92_03660         CDS       T02349                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fts  Francisella tularensis subsp. holarctica F92
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fts03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
655282..657120
Genome map
AA seq 612 aa AA seqDB search
MYKTFHKACEQLADIRAIDFFFAKEVFDLVKKTTPSMTTLSSESYPPFHGAKGNDLEQKS
NEILFHILMKLMHVYSHGHSCLKIADISNKTIFASEQSNQSDAKVGFKMPSSDKIASILD
NFYDNLPIYFAKQYDSLYIKRLWNYENEIANFIKLKTIQNTQKDNRIEEVVDKLFEPAGE
INWQKQAVIKSLNYNFSIISGGPGTGKTTTVAKLLLAIQMLNQNQQRIALLAPTGKAAQR
MTESLKNTLATVIPSSLTTESTIQKNDIFKQVQDELNSVAQYLNNLEAQTIHRFLGLRPN
STYVKYNQQSKAPFDVIIVDEASMLDMNIFIKLIRAVADNTKLILIGDTNQLPSVEAGSL
LANFTHDKYGSITPYTTLLIKNYRSQQYINNLAASVLKGDVNIDSQQNENIKFHSLRNLD
IYLREYAKRYSQLEKCRDYKEALTELNKFRILVANKNLEIGTDKLNQKIEKFMSKPIDSN
YKGKPIMITQNSYSLGLFNGDVGIMWPDDTGKLRAYFDGKDAKAFSLNMLPKYESVYAMT
IHKTQGSEFDEIVIILPAEDNEALSKQLLYTAITRAKYKLTIISEQSSLRDIAQKDINRN
SNISELVSLSTQ
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaactttccataaagcttgtgagcaattagcagatattagagccatagatttt
ttctttgctaaagaggtgtttgatttagtcaaaaagactactccgtctatgaccacttta
tcaagtgagtcatatccaccctttcacggagcaaaggggaatgatttggaacaaaaaagt
aatgaaattttatttcatattttgatgaagcttatgcatgtgtatagtcatggtcatagc
tgtttgaagatagcagatatatcaaataaaactatttttgcttcagagcaaagtaatcag
agtgatgctaaagtaggctttaaaatgccaagctctgataaaattgcaagtattttagat
aacttttacgataatttacctatatattttgccaaacagtatgattctttgtatattaaa
agattgtggaattatgagaatgaaatagctaactttataaaattaaaaacaatccaaaat
actcaaaaagacaatcgtattgaagaagttgtagacaaactatttgaacctgctggtgaa
atcaactggcaaaaacaggcggttatcaaaagtctaaattataattttagtattatctca
ggtggacctggtacaggtaagacaactacagtcgcaaagcttttacttgctatacaaatg
cttaatcaaaatcagcaaagaatagcgcttttagcaccaactggtaaggctgctcagaga
atgacagagtcattaaaaaatactctagcaactgtcattccgtcaagcttgaccacagaa
tctactatacaaaaaaatgatatctttaaacaagttcaggatgaacttaatagtgttgct
cagtatcttaataatctagaagcacaaactatacatagatttttaggcttaagaccaaac
tctacttatgttaaatataaccaacaatctaaagctccattcgatgttattattgttgat
gaagcttcgatgcttgatatgaatatttttatcaagttaattagagctgtagcagataat
actaagttgatattaataggtgatactaatcagttaccatctgttgaggctgggagtctt
ttagcaaactttacacatgataaatatggtagcattacgccatatacaacattacttatc
aaaaactatcgttcacaacaatatataaataatcttgcagcctcagtcctaaaaggcgat
gttaatattgatagtcaacaaaatgaaaatattaaatttcatagtctaagaaatttagat
atttatttaagagagtatgcaaagagatattcacagcttgaaaagtgccgtgactacaaa
gaggctcttacagagctgaataaatttagaatacttgtggctaacaaaaacctagaaatt
ggtacagataagttaaatcagaaaattgagaagtttatgtctaagcctatagattctaac
tataagggtaaaccaattatgataactcaaaatagttattcattagggttatttaatgga
gatgtagggattatgtggcctgatgatactggtaagctccgagcatattttgatggtaaa
gatgctaaggcatttagtctaaatatgctaccaaaatatgaaagtgtttatgcgatgaca
attcataaaactcaaggctcagagtttgatgaaatcgtgattattcttccagcagaagat
aatgaagcgctaagtaaacaacttttgtatacagctattactagagcaaaatataaatta
acgattatatctgaacaaagtagcttaagagatattgctcagaaagatattaatagaaat
tcaaatatcagtgaattagttagcttgagcactcaataa

DBGET integrated database retrieval system