KEGG   Francisella tularensis subsp. holarctica F92: F92_05000Help
Entry
F92_05000         CDS       T02349                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fts  Francisella tularensis subsp. holarctica F92
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fts00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    F92_05000
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    F92_05000
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    F92_05000
Enzymes [BR:fts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     F92_05000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
881462..882385
Genome map
AA seq 307 aa AA seqDB search
MAASCACYAAAAKMPCFIIVPEGVAAYKLAQVMSYGGKIVQVKGSYNEAAKLAYDIAKSK
DFFLAGDYAFRVEGQKTAAFELIDQLLFQVSDEVIIPIGCGTNMTAYYKGFCEYKELGFI
NSLPKLTGVQSTEADTLARAYQKNQNRIEPLKTANTIATAIAVPYPIDGDKAIDAIYSIG
GESTAVTDMKMLEAQYLLSTKEGLFVELASASTIAHLLKKYEEGRLQKGSTVVCVLSGEG
LKDPGVVLKSAIQPPIIYPSETDFDRLYNSHFFDNKTMLFIEQNEVIFDKLPILDEVKKT
LGKLFWC
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttcatgtgcttgttacgctgcagctgcgaagatgccttgctttattattgtg
ccagaaggtgtagcagcttataagttggctcaggtaatgtcttatgggggaaaaatagtt
caggttaagggtagttataatgaagctgcaaagttagcttatgatattgcaaaatcaaaa
gatttcttcttggctggagactatgcttttagagttgaaggtcaaaaaaccgcagcattt
gaactaatagatcagttattgttccaagtgtcagatgaggttataatacctataggttgt
ggcacaaatatgacagcttattataaaggtttttgtgagtataaagagttaggttttatt
aattctttacctaagcttactggtgttcaatctactgaagctgataccttagctagagca
tatcagaaaaatcaaaatagaattgagcctctaaaaacagcaaatacaatagcaacagca
atagctgtgccgtatcctatcgatggtgataaagctatagatgctatatatagtataggt
ggagaatctacagctgtaacagacatgaaaatgctagaggctcaatatttgctatctact
aaagagggattatttgttgagttagcatccgcgtcaactattgcacacttactcaaaaag
tatgaggaaggaaggcttcaaaaaggtagtacagtagtatgtgtattatctggagaaggt
ctaaaagatccaggtgttgtgcttaaatcagctattcaaccaccaattatatatccttca
gaaacagattttgacagactgtataatagtcatttttttgacaacaagacgatgttattt
atagagcaaaatgaagttatatttgataaattacctattcttgatgaagtcaaaaaaact
cttggtaaacttttttggtgctaa

DBGET integrated database retrieval system