KEGG   Francisella tularensis subsp. holarctica F92: F92_05130Help
Entry
F92_05130         CDS       T02349                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fts  Francisella tularensis subsp. holarctica F92
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fts00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    F92_05130 (ruvA)
Enzymes [BR:fts01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     F92_05130 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
902009..902659
Genome map
AA seq 216 aa AA seqDB search
MISFIKGVLIEKDPTALLIDVNGIGYEVFVPMTTFYTLGDIDSQVSLYTHFVVREDAQQL
YGFKSKVDKKVFQELIKVNGIGARTAIAILSGMDSKTLLHCIENKDYALLATVPGIGKKT
AERLVVEIYDKLLKMANEIYAQTSGTTTTSQDSQAQQAPTSVVLANSIFNESVDALLALG
YKQKDAEKMARSAMGDATTAAEVIRKALQGSIKSKG
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgataagttttataaaaggtgtattgatagagaaagatccaacagctttgcttattgat
gtaaatggtattggttatgaagtttttgtaccgatgacaacattttatacattaggtgat
attgatagtcaggttagcctttatacacattttgtagttcgtgaagatgctcagcaactc
tatgggtttaaatcaaaagttgataagaaagttttccaagagttaattaaagtcaatggt
ataggagctagaacagctattgctattttatctggtatggattcaaaaactctattacat
tgtattgaaaataaagattatgctttattagctacagtgccaggaattggtaaaaaaact
gctgagcgtttagttgtagaaatttatgataagttattaaaaatggctaatgagatttat
gctcagacttcaggtacaactacaactagtcaagattcacaagcacaacaggcaccaaca
tctgtagtattagcaaactcaatatttaacgaatccgttgatgcattattggcattaggc
tataagcaaaaagatgctgaaaaaatggctcgctctgctatgggtgatgcaactacagca
gcagaggtaattcgtaaagctctgcaaggatcaataaaatcaaaaggataa

DBGET integrated database retrieval system