KEGG   Francisella tularensis subsp. holarctica F92: F92_07880Help
Entry
F92_07880         CDS       T02349                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fts  Francisella tularensis subsp. holarctica F92
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fts00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    F92_07880
DNA repair and recombination proteins [BR:fts03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      F92_07880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1335986..1336588
Genome map
AA seq 200 aa AA seqDB search
MTSKIFSPKISAVIESLRKLPTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKC
VYCQALTEDDVCNICSNTNRDDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLDGI
GPSELKLDILQQIIADRKIDEVILAISPTVEGETTAHFISQMIAKDIKISRIGFGVPFGG
ELEYLDQQTLLHAFNTRTNI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcaaaattttttctccgaaaattagcgctgtaatagaatctttgcgtaagcta
ccaactattggtaaaaaatcatcacaaagacttgctctatatctactagataaatcacct
gaaacagcaatagctattgccaactcgcttttagatgccacagcaaatatcaaaaaatgt
gtatattgccaagcacttactgaagacgatgtttgtaacatatgtagtaacactaatcga
gatgataccaaactatgtataatagaaagtatgcttgatatgattgctattgaagaggct
ggtatctatagaggtaagtattttgtattaaatggtagaatttctccactagatggcata
ggtccaagtgaattaaagctagatatcttacaacaaattatcgctgatagaaaaatcgat
gaggtaattcttgcaattagcccaactgtagaaggtgaaacaacagctcattttatttca
caaatgattgccaaagatataaaaatctcacgcatcggttttggagtaccatttggtggt
gaattagaatacttggatcaacaaactttactacatgcttttaatacaagaactaatatt
taa

DBGET integrated database retrieval system