KEGG   Francisella tularensis subsp. holarctica F92: F92_08600Help
Entry
F92_08600         CDS       T02349                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fts  Francisella tularensis subsp. holarctica F92
Pathway
fts00020  Citrate cycle (TCA cycle)
fts00640  Propanoate metabolism
fts00660  C5-Branched dibasic acid metabolism
fts01100  Metabolic pathways
fts01110  Biosynthesis of secondary metabolites
fts01120  Microbial metabolism in diverse environments
fts01130  Biosynthesis of antibiotics
fts01200  Carbon metabolism
Module
fts_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fts_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fts00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    F92_08600 (sucC)
   00640 Propanoate metabolism
    F92_08600 (sucC)
   00660 C5-Branched dibasic acid metabolism
    F92_08600 (sucC)
Enzymes [BR:fts01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     F92_08600 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFX71181
Position
1476417..1477580
Genome map
AA seq 387 aa AA seqDB search
MNLHEYQAKDLLESYGLKVQKGIVAHNPNEAAQAFDQLGGKFAVVKAQVHAGGRGKAGGV
KVVKSSQEAREVAESLIGKNLVTFQTDAEGQPVNSVGIFEDVYPVTRELYLGAVVDRSSR
KVTFMASTEGGVDIEEVAHNSPEKILKVEVDPLVGLQPFQAREVAFKLGLEGKQINDFVK
TMLGAYKAFIECDFALFEINPLAVRENGEIVCVDGKINLDSNALYRHPKLLALRDKSQEN
AKELKASEHELNYVALEGNIGCMVNGAGLAMATMDIIQLYGGKPANFLDVGGGATKERVI
EAFKLILDDENVKAVLINIFGGIVRCDMIAEAIIEAVKEVNVTVPVVVRLEGNNAEKGAK
ILADSGLKLIPADGLADAADKVVKSLG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaagctaaagatcttttagaaagctatggtctaaaagttcaa
aaaggtatcgtagctcataacccaaatgaagctgctcaagcatttgaccaattaggtggc
aaatttgctgtggttaaagctcaggtacatgctggtggtcgtggtaaagctggtggtgta
aaggttgttaaatcatctcaagaagctcgtgaagtagcagaaagcttaatcggtaaaaat
cttgttactttccaaactgatgctgaaggtcagccagttaattctgtaggtatatttgaa
gatgtataccctgttactcgtgagttataccttggtgcggtagttgatagatctagccgt
aaagtaacattcatggcttcaactgaaggcggtgtagatattgaagaagttgcacacaac
tctcctgaaaaaatccttaaagtagaagtagatcctttagttggcttacaacctttccaa
gctcgtgaagtagctttcaagcttggtctagaaggcaagcaaatcaatgattttgttaaa
actatgctaggcgcttacaaagcattcatcgaatgtgattttgccctatttgaaatcaac
cctcttgcagttagagaaaacggagagattgtctgtgttgatggtaaaatcaaccttgat
tcaaatgctctttatagacaccctaaacttttagctctaagagacaaatctcaagaaaat
gctaaagaacttaaagcttcagagcatgagctaaactatgtagctcttgaaggtaacatc
ggttgtatggtaaacggtgctggtctagcaatggctactatggatattatccaattatac
ggtggtaagcctgctaacttcctagatgtaggtggtggtgctactaaagagagagtaatc
gaagctttcaaactaatcctagatgatgaaaatgtaaaagctgttttaattaacatcttc
ggtggtattgttcgttgtgatatgatcgctgaagcaattattgaagctgttaaagaagta
aatgtaactgtaccagtagttgttcgtctagaaggtaacaatgcagaaaaaggtgctaaa
atattagctgattcaggtttaaaactaatacctgctgatggtttagctgatgctgctgat
aaagttgtgaaatcactaggttaa

DBGET integrated database retrieval system