KEGG   Francisella tularensis subsp. holarctica F92: F92_09640Help
Entry
F92_09640         CDS       T02349                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
fts  Francisella tularensis subsp. holarctica F92
Pathway
fts01040  Biosynthesis of unsaturated fatty acids
fts01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fts00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    F92_09640
Enzymes [BR:fts01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     F92_09640
Lipid biosynthesis proteins [BR:fts01004]
 Desaturase
  First
   F92_09640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase EcsB FA_hydroxylase RseC_MucC
Motif
Other DBs
NCBI-ProteinID: AFX71356
Position
complement(1662157..1663323)
Genome map
AA seq 388 aa AA seqDB search
MNNNEIIHQTIEKQGSIVWKSVFGLLLLPLVALIAIPWYAMTYGFSTSDYVCLVVFYMLT
GVGITMGYHRLWSHKTYKANKIVSYALLLFGTAALQNSVIQWSSDHRKHHKDVDDPIKDP
YAATRGFWFSHFGWLLRHSSPDVQEIRGVNDLLKDKALVFQHNHYTVLAILSCFGLPVLL
GFIFGFLSGHTLTAAWHSALGFLLLGGLLRVILVHHATFCINSLAHTIGKRPYSTKNTAR
DSWITAIVTGGEGYHNYHHAFAGDYRNGIRWFDLDPSKWFIAGLAKIGWCYDLKTTPKHL
IEIAKAKVKLEEALTKKNKTFHLGIEEKYAKLVANVKNMYNAKQEYLKAKKDNVLSKADI
KEIKSKYKDLKIEFIQAKKKYNKASTIA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaataataatgaaataatacaccaaaccatagaaaaacaaggtagcatagtctggaag
agtgtttttgggttgctacttctaccattggtggcgcttatagctattccttggtatgct
atgacttatggcttttcaacatcagattatgtatgtctagtagttttctatatgcttact
ggtgttggtattacaatgggttaccatagactgtggtcacataaaacatataaggcaaac
aaaatagtaagttatgctcttttattatttggcacagcagcactacaaaatagtgtaatt
cagtggtcttcagatcacagaaaacaccataaagatgttgatgatcctatcaaagatcca
tatgctgctacacgtggtttctggttttcacattttggctggttactaagacatagtagt
cctgatgttcaggaaatcagaggtgtaaatgatcttctaaaagataaggcactagtattt
cagcataatcattacactgttttagcgatattatcgtgttttgggttgcctgtattgcta
ggttttatattcggattcttgagcggtcatacacttacggctgcttggcacagtgcttta
ggctttttactattaggtggtctacttagagttatattggttcatcatgcgactttttgt
atcaactctctagcacatactattggtaaaagaccttattctacaaaaaatactgctagg
gatagctggataacagctatagtaacaggtggtgagggttatcataattatcaccatgct
tttgctggtgattatagaaatggtattagatggtttgatttagacccatctaagtggttt
attgctggcttagctaagattggttggtgttatgatcttaagacaacacctaagcattta
attgaaattgctaaagcaaaagttaaattagaagaagcattaactaagaaaaataaaact
ttccatttaggtattgaagagaagtatgctaagcttgttgcaaatgttaaaaatatgtat
aacgctaagcaagagtacttaaaagctaagaaagataatgttttgtctaaagctgatatt
aaggagattaaatcaaaatataaagatttaaaaatcgaattcattcaagctaagaaaaaa
tataataaagctagtactatcgcctaa

DBGET integrated database retrieval system