KEGG   Francisella tularensis subsp. holarctica F92: F92_09880Help
Entry
F92_09880         CDS       T02349                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fts  Francisella tularensis subsp. holarctica F92
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    F92_09880
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    F92_09880
  Amino acid metabolism
   00310 Lysine degradation
    F92_09880
Enzymes [BR:fts01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     F92_09880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1705237..1706706)
Genome map
AA seq 489 aa AA seqDB search
MVELKVPMFPESVADGTLAQWNKNEGDFVNEGDILAEIETDKVVLEVPATSSGVLKGIKK
HAGDTVLSEESLAIIDTAVSTSEPNQQTTNQGNASEATATGQEIDIKAPVFPESVADGTI
SEWHKKEGEAVSEGDILAEIETDKVVLEVPATSNGVLTKILKTAGETVLSAELIAKITAG
GATATTKSEASVGVSQANNDPHLVPSARKAFNASGLDTAANIEGTGKKGRITSEDVKKAV
ASVNKPQQQTVVINQGARYEKRVKMTRLRQTIANRLVEVQHTNAILTTFNEVDMSAVMEL
RNKYKDMFVKEHDTKLGFMSFFIKAATEALKKFPDVNASIDGDEIVYHNYFDIGIAVGTD
RGLVVPVLRDTDTKSLAELEADVLDKAIKGRDGKLSLEDMQGGTFTITNGGTYGSMLSTP
IINSPQSAILGMHNIVERPVVVKGEIKIRPIMYLALSYDHRIIDGGTSVRFLKMIKELIE
DPNRILLQV
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggttgaattaaaagtacctatgttcccagagtctgtagcagatggcacattagctcaa
tggaataaaaacgaaggtgactttgtaaatgagggcgatatcttggcagagattgagact
gataaagttgttctagaagtacctgcaacatctagtggtgttttaaaagggataaaaaaa
catgctggtgatacagtgctttcagaagagtcattagcgatcattgatactgctgtttct
acatctgaacctaaccaacaaactactaatcaaggaaatgcttcagaagcaactgctact
gggcaagaaattgatattaaggcgcctgtatttccagagtctgtagcagatggcacgatc
tcagagtggcataagaaagagggtgaggctgtttctgagggtgatatcttagcagagatt
gagactgataaggttgttctagaggttccggcaacatcaaatggtgttttgacaaaaata
ttaaaaacagcaggagagactgtactatctgcagagcttatcgctaagattacagcagga
ggcgcaactgctactacgaaatcagaagcttcggtgggagtttctcaagcaaataatgat
ccgcatctagtaccttcagcacgtaaagcttttaatgcaagcggcttggatactgctgct
aatatcgaaggtacaggtaaaaaagggcgtataacttctgaagatgtcaaaaaagcagtt
gcatcagtaaataaacctcaacaacagacagttgttataaatcaaggtgctagatatgaa
aaaagagtcaagatgactcgtctgcgtcagactatagcaaataggttagttgaggttcaa
catactaatgcaatcttaactactttcaatgaagtagatatgagtgcagttatggagctt
agaaacaaatataaagatatgtttgtcaaagaacatgatactaagcttggctttatgtct
ttctttatcaaagcagcaacagaagcacttaagaaattcccagatgtaaatgcctctatt
gatggtgatgagattgtttaccataattattttgatattggtattgctgtaggtactgat
aggggtctagtggtacctgtactaagagatacagatactaaatctctagctgaattagaa
gccgatgttttagacaaagcgattaaaggtcgtgatggtaaattaagccttgaagatatg
caaggtggtacatttacgattacaaatggcggaacttatggttcgatgttatctacgcct
attattaattcaccgcaaagtgctattttaggtatgcataatattgttgagcgtcctgta
gttgttaagggtgagattaagattcgtccaattatgtatttagcgttatcttacgaccat
agaatcattgatggcggtacatctgtaagattcttgaagatgatcaaagagctaattgaa
gatccaaatagaattcttctacaagtatag

DBGET integrated database retrieval system