KEGG   Francisella tularensis subsp. holarctica F92: F92_10865Help
Entry
F92_10865         CDS       T02349                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
fts  Francisella tularensis subsp. holarctica F92
Pathway
fts00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fts01100  Metabolic pathways
fts01110  Biosynthesis of secondary metabolites
fts01130  Biosynthesis of antibiotics
fts01230  Biosynthesis of amino acids
Module
fts_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fts00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    F92_10865
Enzymes [BR:fts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     F92_10865
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     F92_10865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AFX71555
Position
complement(1877088..1878449)
Genome map
AA seq 453 aa AA seqDB search
METILEKIVEAKRKWLFAKKRLFPLDVFKKEVVKTDRDFYQALESDKAVFILECKKGSPS
KGIIRKKFDLNEIAAVYKNYANVISVLTDEEFFMGSFANLEIVRKQVTQPMLCKDFIIDE
YQIFLARHYQADAVLLMLSVLDDSEYKKLAKVANRLGMGILTEVSNEEELVRAISLKAKV
IGINNRNLRDLSIDLNTTRLLAPKIPKRTIIISESGIYKNQEIRDLRNYVNGFLIGSSIM
GERNLELAVRKLVYGFNKVCGLTSVEDAQKAYDAGAVYGGLIFVEKSPRYVDFAMAKQIV
KKVRLNYVGVFADAKIEDVVDTCYALKLSAVQLHGDENQEYIDTLKSKLHRNCQIWKAYP
VDKTLPSFFANVDYHLLDAQVDGKSGGTGKTFDWSLIKDRKNIILAGGLNAKNIAKAIEL
KCSAYDINSGVESEPGQKDQIKLNEVFEIIRSY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaaactattttagaaaaaatcgttgaagcaaaaagaaagtggctttttgcaaaaaaa
agactatttccactagatgtatttaaaaaagaagttgtcaaaacagatagagatttctat
caagctttggaatctgataaagctgtatttattttagaatgtaaaaaaggctctccttct
aaaggaattattcgtaaaaagtttgatctaaatgaaattgcagctgtatacaaaaattat
gcaaatgtgatatctgtacttacagatgaagaattttttatgggtagctttgcaaatcta
gagattgttagaaagcaagtaacacaacctatgctttgtaaagattttataatagatgaa
tatcaaatattcttagctaggcattatcaagctgatgctgtgttacttatgctttcagta
cttgatgatagtgagtataaaaaattagcaaaagttgctaatcgtctaggtatgggtata
ttaaccgaagttagtaacgaagaagagcttgtaagagctataagcttaaaagcaaaagtt
ataggtattaataatcgtaatctaagagatctttctatagatttaaatactacgcgtctt
ttagctccgaaaatacctaaaagaacaattattatttcagaatcagggatctataaaaat
caagaaatacgtgatctaagaaattatgtaaatggctttttgataggaagttctattatg
ggtgaacgtaaccttgaacttgcagttagaaagcttgtttatggttttaataaggtttgc
ggccttacttctgttgaggatgctcaaaaagcatatgatgcaggagcagtctatggtggt
ttgatttttgttgagaaatctcctcgttatgtagattttgctatggcaaaacagatagta
aaaaaagttaggctaaattatgtaggtgtttttgctgacgctaaaatagaagatgttgta
gatacctgctatgcattaaaattaagtgctgtgcagttgcatggtgatgaaaatcaagag
tatatagatactctaaaatcaaagctacatagaaactgtcaaatatggaaagcatatcca
gtagataagactcttccaagtttttttgctaacgtagattatcatttattagatgcccaa
gtagatggtaaatcaggtggtacaggaaaaacatttgattggagtcttatcaaagacaga
aaaaatataattcttgctggcggtctgaatgctaaaaatatagcaaaagcaatagaattg
aagtgttcagcttatgatattaattctggtgtagaatctgaaccaggacaaaaagatcaa
atcaaactaaatgaagtatttgaaataattagaagttattaa

DBGET integrated database retrieval system