KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_0069Help
Entry
FTV_0069          CDS       T01761                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
Pathway
ftt00020  Citrate cycle (TCA cycle)
ftt00190  Oxidative phosphorylation
ftt00650  Butanoate metabolism
ftt01100  Metabolic pathways
ftt01110  Biosynthesis of secondary metabolites
ftt01120  Microbial metabolism in diverse environments
ftt01130  Biosynthesis of antibiotics
ftt01200  Carbon metabolism
Module
ftt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ftt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ftt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ftt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FTV_0069 (sdhD)
   00650 Butanoate metabolism
    FTV_0069 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    FTV_0069 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DoxX
Motif
Other DBs
NCBI-ProteinID: AFB79833
Position
74282..74650
Genome map
AA seq 122 aa AA seqDB search
MGVLLMAVISLTSSGIKDFFVQRVTAVIIAVYFGYLILEALYLSHIGALNYDSWRGLFTD
GMFFRVATLMAYLAMFFHAWVGIWIICGDYIKFAWASALVMLSFVLVYIFCFFWLFAVLF
FY
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgttacttatggctgtaatttcattaacttcttctggaattaaagactttttc
gtacaaagagttacggctgtaattattgctgtatattttggttatcttatcctagaagct
ttgtatttgtcgcatataggagctcttaactatgatagttggagaggtttgtttaccgat
gggatgttttttagagttgctacgttaatggcgtacttggcgatgttttttcatgcatgg
gtaggtatctggattatatgtggcgattatattaaatttgcttgggcttctgcgcttgtg
atgctgagctttgttttggtgtatatattctgctttttttggttatttgcagttttattt
ttctattaa

DBGET integrated database retrieval system