KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_0184Help
Entry
FTV_0184          CDS       T01761                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
Pathway
ftt00220  Arginine biosynthesis
ftt00250  Alanine, aspartate and glutamate metabolism
ftt00471  D-Glutamine and D-glutamate metabolism
ftt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FTV_0184
   00220 Arginine biosynthesis
    FTV_0184
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    FTV_0184
Enzymes [BR:ftt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     FTV_0184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Ank_4 Ank_2 Ank_3 Ank Ank_5 EF-hand_7
Motif
Other DBs
NCBI-ProteinID: AFB79940
Position
complement(212468..214009)
Genome map
AA seq 513 aa AA seqDB search
MKTIMIKTTSSSGEDYYKNIFSAICDKDGFMTKTDILDILVESGISNDDPRITKLIAKLN
KFCDIDKIDFDTFQEITFENIGLIEKAINKGFIIPNFKDFKKEIEAIYNETKKNETGRNA
NYIPQLARVDPNLFAVAFCSVDGQIITLGDYLQPYCVQSTAKTITYCIATEENGEDKVHQ
HVGREPSGITFNAIALNKYDLPHNPMINSGAIMMCSLIKPEWNLADRFEYITNVWQDLAG
GEPIGFDNAVYHSEKETADRNYALAHFMKEVGAFPEGTNIHTALDFYFQTCSIQVNAKKM
AKIMASIANGGVCPFTSKKIFSPTTIRNCLSMMYSCGMYDFSGEYAFSVGLPAKSGVSGA
LAIAIPNVGGFAIFSPRLDPNHNSVRGVEFSKRLIEKFSFHNYDHITHCDKINPVENRMV
VESNLTFELIWAASAGDLSEIKRAVALGVDINKGDYDKRTALHLAAAEGHEDIVKYLIRK
GADINAIDRWGKKPLDDAIMNNNISIIELLDRT
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaataatgattaaaactacatcttctagtggtgaagattactataaaaatatt
tttagcgctatctgtgacaaagatggctttatgacaaagacagatattcttgatatctta
gttgagtcaggtattagcaatgatgatcctcgcattactaaattaatcgccaaattaaat
aaattctgtgatattgataagattgattttgatacatttcaagaaattacttttgaaaat
ataggtcttatcgaaaaagctattaataaaggctttatcattcccaactttaaggatttc
aaaaaagaaattgaagccatatataacgaaactaaaaagaatgaaacaggcagaaacgca
aactatattcctcaactagcaagggttgaccctaatctttttgctgtggctttttgtagt
gttgatggtcaaataattaccttaggagattatctacaaccatactgtgtacaatcaact
gcaaaaactatcacatattgtatagctactgaagaaaatggcgaagataaagttcatcaa
catgttggcagagaaccaagtggtattacttttaatgctatagcattaaacaagtatgac
ctacctcataatccaatgataaactccggcgctatcatgatgtgctcactaataaaaccg
gagtggaatcttgctgatagatttgaatatattactaacgtttggcaagatctagcaggt
ggcgaacctatcggctttgataacgctgtatatcactccgaaaaagagaccgcagataga
aattatgctctagctcattttatgaaagaagtaggtgcttttccagagggcacaaatatc
cacactgctctagatttctatttccaaacttgctctattcaagttaacgcaaaaaaaatg
gcaaaaattatggcttccatagctaatggcggagtatgcccttttactagtaaaaaaata
ttttcaccaacaacgattcggaattgcttatcaatgatgtactcgtgtgggatgtatgat
ttttcaggtgaatatgcgttctctgttggattacctgcaaaatcaggggtgtcaggagct
ctagctatagctattccaaatgttggtggttttgcaattttttctcctcgacttgaccct
aatcataactccgtaagaggtgttgaatttagtaaaaggctaatagagaagtttagtttc
cataactatgatcatataactcattgtgacaaaataaatcccgttgagaatagaatggtt
gtcgaatcaaatttaacatttgaactaatttgggcagcaagtgccggtgacttatcagag
attaaaagagccgttgccttaggtgttgatattaacaaaggtgattatgataaaagaaca
gctcttcacctagccgctgctgaaggtcatgaagatattgttaaataccttatccgcaaa
ggagcggatattaatgctatagacagatggggtaaaaagccattagatgatgctataatg
aataataatatttctataattgagctgttagacagaacttaa

DBGET integrated database retrieval system