KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_0383Help
Entry
FTV_0383          CDS       T01761                                 

Gene name
glgB
Definition
(GenBank) 1 4-alpha-glucan (glycogen) branching enzyme GH-13-type
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
Pathway
ftt00500  Starch and sucrose metabolism
ftt01100  Metabolic pathways
ftt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ftt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FTV_0383 (glgB)
Enzymes [BR:ftt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     FTV_0383 (glgB)
Exosome [BR:ftt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FTV_0383 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: AFB80124
Position
complement(422447..424369)
Genome map
AA seq 640 aa AA seqDB search
MKNKNSEQNTHSTIGEQDIHYFHEGKHIYAYEFMGAHKACEEGIEGIRFTTWAPNAKSIC
VIGDFNYWQVEDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTNHYVYKSDPYAFF
SELRPNTASIITTETQYTWSDDKWLEKRAKTNYYDNPMNVYELHLASWKTKNGKFLTYDE
LSETLPQYIKEMGYTHVEFMPLHEHPLDASWGYQPTGFYSVNSRHGDIIGLKRLVDKLHN
NDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAINKGWGTHNFDLGRNEVKCFLI
SNAMYWINEFHIDGLRVDAVSNILYLNYDREDGQWIPNIYGGHENLEGIAFLKELNGVLK
HTCKGVITIAEESSSWPDISTPVEKGGLGFDFKWNMGWMNDTLRYISLDPVYRKYHHNLI
TFSMVYHYSEKFILSISHDEVVHGKKSLINKMWGDLWNKYAGLRLYMSYMIGHPGKKLIF
MGSEFVQFVEWREYEQLQWQVVDQYESHKQTLHFFKKLNDFYHNETALWQCDYNHHGFRW
IDADNSQQSILSFIRSSKDNKQKLIFICNFTPVTYYDYHLGVPDAGSYKEVFNSDNLEFG
GSGQVMATEIFSSLQSSHGFEQRITIKIPPMATLVLKLIK
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaaaattcagaacaaaatactcactctactattggcgaacaagatattcat
tacttccatgaaggtaagcatatatatgcatatgaatttatgggggctcacaaagcatgt
gaagaagggattgaaggtattagatttacaacatgggctccaaatgcgaaaagtatttgt
gttataggtgactttaactattggcaagttgaagataaaaactatatggaacctatcact
gatgctggactatggagtgtttttatcccaaatgcaaaaaatggtgataaatataagttt
gtagtaactaataaagatactaatcattatgtctataaaagcgacccttacgcttttttc
tctgaactaagaccaaatacagcttctataatcactactgaaactcaatatacctggagt
gatgataaatggctagaaaagcgcgctaaaactaactactatgataaccccatgaatgtt
tatgagctacatttagcctcatggaaaactaaaaatggtaaattcttgacatatgatgag
ctaagtgaaactctacctcaatatatcaaagaaatgggctatactcatgttgaatttatg
ccgttacacgagcatcccttagatgcttcatggggctatcaacctactggcttttattct
gtaaatagccgtcatggagacataattggcttaaagcgcctagtagataaactacacaat
aatgacataggcgtaattctagattgggttccagggcatttctgtaaagatcaacatggt
ttaatatactttgatggaagtccatgttatgagtatcaagagcctacaaaagcaatcaac
aaaggttggggaacacataattttgacttaggcagaaatgaagtaaaatgctttttgatt
tcaaatgcaatgtactggattaatgagtttcatatagacggcttacgtgttgatgcagtg
tcaaatattctttatcttaattatgatagagaagatggtcaatggataccaaatatttat
ggcggtcatgaaaaccttgaaggtatagcttttcttaaagaactaaatggagttctaaaa
cacacctgcaaaggcgttattactattgctgaagaatcttcctcttggccagatatttca
acccccgttgaaaaaggcgggttaggatttgactttaaatggaatatgggatggatgaat
gataccttaaggtatatctcgctagatccggtttatcgtaaatatcatcataacttgata
actttttccatggtctatcattattcagaaaagtttattctttcgatctcgcatgatgag
gtagttcatggcaagaaatctttgattaataaaatgtggggagacttgtggaataaatat
gctggactacgtttatatatgtcatatatgattgggcatcctggtaaaaagcttattttc
atgggtagtgagtttgtccaatttgtcgaatggcgcgaatacgaacaactccaatggcaa
gtagttgatcaatacgaatctcacaaacaaactctacattttttcaaaaaattaaatgat
ttctaccataatgaaactgcactgtggcagtgtgactataatcatcatggtttcagatgg
atagacgctgataactcgcagcaaagtatcctatcttttattagaagtagtaaagataat
aaacaaaagctaatttttatttgcaacttcactccagttacatattatgactatcattta
ggagtaccagatgcaggatcatacaaagaggtatttaactcagataaccttgaatttggt
ggttctggacaagttatggctacagagattttctcctcactacagtcatcacatggattt
gagcaaagaattacaatcaaaatccctcctatggcaacactcgtactcaaacttattaaa
taa

DBGET integrated database retrieval system