KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_0388Help
Entry
FTV_0388          CDS       T01761                                 

Gene name
malA
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FTV_0388 (malA)
Enzymes [BR:ftt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     FTV_0388 (malA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
431511..432974
Genome map
AA seq 487 aa AA seqDB search
MRKAGLLLAISSLPSWFGIGDLGKSAYEFVDILKQASIRIWQVLPLTTLGFGNSPYQSSS
SFAGDEIYISLEKLADYGLLEESSLKKLNANSKKVEYELVRNFKDNYLEEAFSNFQSSKD
KFEQEYSDFITQNSWVKNYAIFKAFRKVNNNQAWNFWPAEYKNWVKEKAIELDQFQQEID
YQIFLQFIFYKQWFELREYANKNNIEIMGDLPIYLGFDSADVWEHQEVFLLDEDQNPSFV
AGVPPDFFSETGQLWGNPLYDWDKLKETNFNFWIDRLNGNFKLFDIVRIDHFRAFDTYWK
IPASEKTAINGEWVEAPGYDFFDTVYKRIPDANIIAEDLGDLRDEVFELRDHYNLKGMKV
FPFHFDLKTARFIDDANIIAYSGTHDNNTLKGWYFDELNRYQRKLLKRYFKANDKNIFSK
IIKYLLSCEAEYVILPVQDVLELDGTARLNTPGTVGAPNWEWKLVDFNLLKSKTNRLAKQ
VSKSINH
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagctggattattattagctatttcaagtttacctagctggtttggcattggt
gatttgggtaaaagtgcgtatgagtttgttgatattttaaaacaggctagtattagaatt
tggcaggttttacctcttacaacactaggtttcggcaactctccatatcagtcaagctct
tcttttgctggtgatgaaatctacattagcttagaaaaactagcagattatggtttgctt
gaagaatcatctcttaaaaaactaaatgcaaactctaaaaaagttgaatatgaacttgtt
cgtaatttcaaagataactatctcgaagaagcatttagtaatttccaaagctcaaaagat
aagtttgaacaagagtatagtgattttataactcagaattcttgggtcaaaaactatgct
atttttaaagcttttagaaaggtaaataataaccaagcttggaatttttggcctgcagaa
tataaaaactgggtcaaagagaaagctatagaacttgatcaatttcaacaagagatagat
tatcaaatatttttacagtttatattttataagcagtggtttgagctaagagagtatgct
aataaaaataatattgaaattatgggtgatttgcctatttatctaggttttgattctgct
gatgtgtgggagcatcaagaagtatttttattagatgaggatcaaaatcctagctttgtt
gcaggagttccacctgactttttctcagaaactggtcagctatggggtaatcctctatat
gattgggataaactcaaagaaacaaattttaatttttggatagatcgactaaatggtaat
ttcaagctatttgatattgttaggattgaccattttagagcttttgatacatattggaag
ataccagccagtgaaaaaactgctataaatggtgagtgggtagaagctcctggctatgat
ttctttgatacagtctataagcgtattccagatgctaatattattgcggaagatttagga
gatttgcgagatgaagtatttgagctacgtgatcactataatttaaagggtatgaaagta
ttcccatttcattttgatctaaaaacagctagatttattgatgatgctaatatcatagct
tattcaggtactcacgataataatactttgaaaggttggtattttgacgagctcaataga
tatcaaagaaaattattaaaacgatattttaaagctaatgataaaaatatctttagcaaa
ataattaagtatttgcttagctgtgaagctgaatatgtaatcctgccagtacaagatgtt
ttagagttagatggaactgctaggctaaatactccgggtactgtaggtgcgccaaactgg
gagtggaagttggttgattttaatttacttaagtcaaaaactaatcgcttagctaaacag
gtatctaagtctataaatcattaa

DBGET integrated database retrieval system