KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_0388Help
Entry
FTV_0388          CDS       T01761                                 

Gene name
malA
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ftt00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
431511..432974
Genome map
AA seq 487 aa AA seqDB search
MRKAGLLLAISSLPSWFGIGDLGKSAYEFVDILKQASIRIWQVLPLTTLGFGNSPYQSSS
SFAGDEIYISLEKLADYGLLEESSLKKLNANSKKVEYELVRNFKDNYLEEAFSNFQSSKD
KFEQEYSDFITQNSWVKNYAIFKAFRKVNNNQAWNFWPAEYKNWVKEKAIELDQFQQEID
YQIFLQFIFYKQWFELREYANKNNIEIMGDLPIYLGFDSADVWEHQEVFLLDEDQNPSFV
AGVPPDFFSETGQLWGNPLYDWDKLKETNFNFWIDRLNGNFKLFDIVRIDHFRAFDTYWK
IPASEKTAINGEWVEAPGYDFFDTVYKRIPDANIIAEDLGDLRDEVFELRDHYNLKGMKV
FPFHFDLKTARFIDDANIIAYSGTHDNNTLKGWYFDELNRYQRKLLKRYFKANDKNIFSK
IIKYLLSCEAEYVILPVQDVLELDGTARLNTPGTVGAPNWEWKLVDFNLLKSKTNRLAKQ
VSKSINH
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagctggattattattagctatttcaagtttacctagctggtttggcattggt
gatttgggtaaaagtgcgtatgagtttgttgatattttaaaacaggctagtattagaatt
tggcaggttttacctcttacaacactaggtttcggcaactctccatatcagtcaagctct
tcttttgctggtgatgaaatctacattagcttagaaaaactagcagattatggtttgctt
gaagaatcatctcttaaaaaactaaatgcaaactctaaaaaagttgaatatgaacttgtt
cgtaatttcaaagataactatctcgaagaagcatttagtaatttccaaagctcaaaagat
aagtttgaacaagagtatagtgattttataactcagaattcttgggtcaaaaactatgct
atttttaaagcttttagaaaggtaaataataaccaagcttggaatttttggcctgcagaa
tataaaaactgggtcaaagagaaagctatagaacttgatcaatttcaacaagagatagat
tatcaaatatttttacagtttatattttataagcagtggtttgagctaagagagtatgct
aataaaaataatattgaaattatgggtgatttgcctatttatctaggttttgattctgct
gatgtgtgggagcatcaagaagtatttttattagatgaggatcaaaatcctagctttgtt
gcaggagttccacctgactttttctcagaaactggtcagctatggggtaatcctctatat
gattgggataaactcaaagaaacaaattttaatttttggatagatcgactaaatggtaat
ttcaagctatttgatattgttaggattgaccattttagagcttttgatacatattggaag
ataccagccagtgaaaaaactgctataaatggtgagtgggtagaagctcctggctatgat
ttctttgatacagtctataagcgtattccagatgctaatattattgcggaagatttagga
gatttgcgagatgaagtatttgagctacgtgatcactataatttaaagggtatgaaagta
ttcccatttcattttgatctaaaaacagctagatttattgatgatgctaatatcatagct
tattcaggtactcacgataataatactttgaaaggttggtattttgacgagctcaataga
tatcaaagaaaattattaaaacgatattttaaagctaatgataaaaatatctttagcaaa
ataattaagtatttgcttagctgtgaagctgaatatgtaatcctgccagtacaagatgtt
ttagagttagatggaactgctaggctaaatactccgggtactgtaggtgcgccaaactgg
gagtggaagttggttgattttaatttacttaagtcaaaaactaatcgcttagctaaacag
gtatctaagtctataaatcattaa

DBGET integrated database retrieval system