KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_0397Help
Entry
FTV_0397          CDS       T01761                                 

Gene name
thrC1
Definition
Threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ftt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FTV_0397 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTV_0397 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FTV_0397 (thrC1)
Enzymes [BR:ftt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FTV_0397 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
443045..444331
Genome map
AA seq 428 aa AA seqDB search
MNFISTRDKNIKVSLSEAMQSGLAPDGGLFVLERFPTVNWQSFAKDISYAKFAANTLREF
FKGDQLEDSLDKICNNAFTFEVPVRRLDKTTSVLELFHGPTLSFKDFGARFLANCLSSID
SEKPFTILVATSGDTGSAVAAAFHGKSNIRVIVMFPKGKISKRQEKQITCWGDNIQAVEV
EGVFDDCQSLVKEAFKTPWWTERTKLNTSNSINIGRLLPQSTYYAYTSWQHYLQTGEKAN
YIVPSGNIGNITAAFWAKQMGFPIGEISMSLNANDTVVDYLETGKFNPKASVETLANAMD
VGNPNNFERLLYLLGNYENFKANVKAICVSDFEIIEEIKQVYRQYHEVVCPHTATGFVAK
NQLDSNKDYIIVATAHPAKFESVIEPILDIQVPPTPALQKLLDKEQNKVVINKSMDELCE
VYTKAFEA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaattttattagtactagagataaaaatattaaagtttcactaagtgaagcgatgcag
tctggattagctcctgatggaggattatttgtcctagagagatttcctacagttaattgg
cagagttttgctaaagatatcagttacgcgaagtttgctgctaatactctaagagaattc
tttaaaggagatcagctagaagactctttagataaaatttgtaataatgcttttactttt
gaggttcctgtaagaagattagataaaaccacatcagttttagagctttttcatggtcca
actttatcttttaaagatttcggtgcgagatttttagcaaactgtttaagctctatcgat
agtgagaagccatttactattttagtggcaacttctggagatacgggttcagcagtagct
gcagcttttcatggtaagagcaatatccgtgttatagtgatgtttcctaaaggtaaaatc
tctaaaagacaagaaaagcagataacttgttggggagataatatccaagcagttgaagtt
gaaggagtttttgatgactgtcaaagtctagtcaaagaagcttttaagacaccttggtgg
acagagaggactaagttaaatacatcaaatagtattaatatcggtagattactaccacaa
tcaacttattatgcttatacatcgtggcaacattatttgcagaccggagagaaagcaaac
tatatagttccatctggcaatattggtaatataactgctgctttttgggcaaagcaaatg
ggctttccaataggtgaaatatcgatgagtttaaatgctaatgatactgttgttgactat
ctagagactggtaagtttaatcctaaggcaagtgttgaaacgctagcaaatgctatggat
gttggtaaccctaataattttgaaagattgttatacttgttgggtaattatgaaaatttc
aaagctaatgttaaggctatatgtgtttctgactttgaaattatagaagaaataaaacaa
gtgtatcgtcaatatcatgaagttgtttgtccacacacagcaacaggttttgtagcaaaa
aatcagttagatagcaataaagattatataatcgtagcaactgcacatcctgctaagttt
gaaagtgtaattgagcctatattagatatacaagtgccgcctacaccggcgttacaaaag
ctactagacaaagagcaaaataaagtagttataaataagtctatggatgagctgtgcgag
gtttatacaaaagcttttgaagcttag

DBGET integrated database retrieval system