KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_0398Help
Entry
FTV_0398          CDS       T01761                                 

Gene name
ebgA
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ftt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FTV_0398 (ebgA)
Enzymes [BR:ftt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     FTV_0398 (ebgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(444432..444662)
Genome map
AA seq 76 aa AA seqDB search
MYFGVDYYPEQWDYSLINEDLNRIANSELNCIRIAEFAWHLMEPIENEFDFSFFEMILNK
AHKLGLKVMLGTPIAT
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgtattttggtgtcgactattacccagaacaatgggattattctcttattaatgaagat
ttaaatcgtatagcaaattctgagttaaattgtattagaattgctgaatttgcttggcat
ctaatggagcctatagaaaatgaatttgattttagtttctttgaaatgatactaaataaa
gctcataagttaggattaaaagttatgttaggaacccctatagcaacttag

DBGET integrated database retrieval system