KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_0398Help
Entry
FTV_0398          CDS       T01761                                 

Gene name
ebgA
Definition
beta-galactosidase (EC:3.2.1.23)
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(444432..444662)
Genome map
AA seq 76 aa AA seqDB search
MYFGVDYYPEQWDYSLINEDLNRIANSELNCIRIAEFAWHLMEPIENEFDFSFFEMILNK
AHKLGLKVMLGTPIAT
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgtattttggtgtcgactattacccagaacaatgggattattctcttattaatgaagat
ttaaatcgtatagcaaattctgagttaaattgtattagaattgctgaatttgcttggcat
ctaatggagcctatagaaaatgaatttgattttagtttctttgaaatgatactaaataaa
gctcataagttaggattaaaagttatgttaggaacccctatagcaacttag

DBGET integrated database retrieval system